|
PID | QueryLength | FocusSite | TITLE |
2993159 | 296 | 206 S | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
AC/ID | AC:Q99836 ID:MYD88_HUMAN |
Feature Table for 206-th site |
VARIANT: /note="S -> C (found in hematological malignancies; uncertain significance; somatic mutation)" /id="VAR_073257" DOMAIN: /note="TIR" VAR_SEQ: /note="HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPS ILRFITVCDYTNPCTKSWFWTRLAKALSLP -> AAGWWWLSLMITCRARNVTSRPNLH SASLQVPIRSD (in isoform 3 and isoform 4)" /id="VSP_043500" CHAIN: /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" |
VARIANT for 206-th site |
S->C US " -" |
Percentages of Amino Acids in Homologous Proteins
![]() |
D:36% S:29% E:15% A:12% T:7% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
![]() |
(coil) | b (buried) | 7.0 |
Predicted Bind Molecules |
homo:14 |
Templates for 3D complexes |
homo [42153:TLR2_HUMAN
] ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() [Back to SiteTable] |
![]() [Back to Search Page] |
![]() [Back to Top Page] |