Summary for the 209-th Site(S) |
PID | QueryLength | FocusSite | TITLE |
2993159 | 296 | 209 S | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
AC/ID | AC:Q99836 ID:MYD88_HUMAN |
Feature Table for 209-th site |
VARIANT: /note="S -> R (found in hematological malignancies; uncertain significance; somatic mutation; constitutively activates NF-kappaB complex activation)" /id="VAR_073259" HELIX: DOMAIN: /note="TIR" VAR_SEQ: /note="HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPS ILRFITVCDYTNPCTKSWFWTRLAKALSLP -> AAGWWWLSLMITCRARNVTSRPNLH SASLQVPIRSD (in isoform 3 and isoform 4)" /id="VSP_043500" CHAIN: /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" |
VARIANT for 209-th site |
S->R US " -" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
S:22% A:16% Q:16% I:15% V:12% H:7% L:5% D:4% G:2% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
2js7 | G (3/10-helix) | e (exposed) | 58.6 |
Predicted Bind Molecules |
homo:4 |
Templates for 3D complexes |
homo [42153:TLR2_HUMAN ] 1fyw_A_1_A_2 1fyw_A_2_A_1 1fyx_A_1_A_2 1fyx_A_2_A_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |