|
PID | QueryLength | FocusSite | TITLE |
2993159 | 296 | 205 W | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
AC/ID | AC:Q99836 ID:MYD88_HUMAN |
Feature Table for 205-th site |
VARIANT: /note="W -> R (found in hematological malignancies; uncertain significance; somatic mutation)" /id="VAR_073256" DOMAIN: /note="TIR" VAR_SEQ: /note="HMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSI ASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPS ILRFITVCDYTNPCTKSWFWTRLAKALSLP -> AAGWWWLSLMITCRARNVTSRPNLH SASLQVPIRSD (in isoform 3 and isoform 4)" /id="VSP_043500" CHAIN: /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" |
VARIANT for 205-th site |
W->R US " -" |
Percentages of Amino Acids in Homologous Proteins
![]() |
V:22% W:20% I:14% F:10% S:9% T:6% R:5% Q:4% A:1% N:1% D:1% E:1% G:1% L:1% K:1% P:1% Y:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
![]() |
(coil) | b (buried) | 17.5 |
Predicted Bind Molecules |
homo:5 |
Templates for 3D complexes |
homo [42153:TLR2_HUMAN
] ![]() ![]() ![]() ![]() ![]() |
![]() [Back to SiteTable] |
![]() [Back to Search Page] |
![]() [Back to Top Page] |