|
|
| PID | QueryLength | FocusSite | TITLE |
| 2932749 | 515 | 318 Y | RecName: Full=Interferon alpha/beta receptor 2; Short=IFN-R-2; Short=IFN-alpha binding protein; Short=IFN-alpha/beta receptor 2;AltName: Full=Interferon alpha binding protein;AltName: Full=Type I interferon receptor 2;Flags: Precursor; |
| AC/ID | AC:P48551 ID:INAR2_HUMAN |
| Feature Table for 318-th site |
VARIANT: /note="Y -> C (no effect on activation of STAT1 upon IFNA2 or IFNG binding; dbSNP:rs756571542)" /id="VAR_084105" MUTAGEN: /note="Y->F: Does not inhibit STAT1, STAT2 and STAT3 activation by IFN. Inhibits STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-306; F- 316; F-337; F-411 and F-512. Inhibits STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-306; F-316; F-411 and F-512. Does not inhibit STAT1, STAT2 and STAT3 activation by IFN; when associated with F-512. Does not inhibit STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-306; F-316 and F-337." ECO:0000269|PubMed:12105218" VAR_SEQ: /note="NFHNFLAWPFPNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAPR -> RQGLAKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD (in isoform 2)" ECO:0000303|PubMed:8181059, ECO:0000303|Ref.8" /id="VSP_001738" REGION: /note="Disordered" TOPO_DOM: /note="Cytoplasmic" VAR_SEQ: /note="Missing (in isoform 3)" ECO:0000303|PubMed:7759950" /id="VSP_001737" CHAIN: /note="Interferon alpha/beta receptor 2" /id="PRO_0000011006" |
| VARIANT for 318-th site |
Y->C LB/B dbSNP:rs7565715 " -" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
Y:100% |
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 318-th Site(Y)