Summary for the 306-th Site(Y)
PID QueryLength FocusSite TITLE
2932749 515 306 Y RecName: Full=Interferon alpha/beta receptor 2; Short=IFN-R-2; Short=IFN-alpha binding protein; Short=IFN-alpha/beta receptor 2;AltName: Full=Interferon alpha binding protein;AltName: Full=Type I interferon receptor 2;Flags: Precursor;
UniProt Information
AC/IDAC:P48551 ID:INAR2_HUMAN
Feature Table for 306-th site MUTAGEN: /note="Y->F: Does not inhibit STAT1, STAT2 and STAT3 activation by IFN. Inhibits STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-316; F- 318; F-337; F-411 and F-512. Inhibits STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-316; F-318; F-411 and F-512. Does not inhibit STAT1, STAT2 and STAT3 activation by IFN; when associated with F-512. Does not inhibit STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-316; F-318 and F-337." ECO:0000269|PubMed:12105218"
VAR_SEQ: /note="NFHNFLAWPFPNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAPR -> RQGLAKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD (in isoform 2)" ECO:0000303|PubMed:8181059, ECO:0000303|Ref.8" /id="VSP_001738"
TOPO_DOM: /note="Cytoplasmic"
VAR_SEQ: /note="Missing (in isoform 3)" ECO:0000303|PubMed:7759950" /id="VSP_001737"
CHAIN: /note="Interferon alpha/beta receptor 2" /id="PRO_0000011006"
Evolutionary Information
Percentages of Amino Acids in Homologous Proteins [show alignment] 
H:44% P:31% Y:25%


[Back to SiteTable]
[Back to Search Page]
[Back to Top Page]