|
PID | QueryLength | FocusSite | TITLE |
2932749 | 515 | 316 Y | RecName: Full=Interferon alpha/beta receptor 2; Short=IFN-R-2; Short=IFN-alpha binding protein; Short=IFN-alpha/beta receptor 2;AltName: Full=Interferon alpha binding protein;AltName: Full=Type I interferon receptor 2;Flags: Precursor; |
AC/ID | AC:P48551 ID:INAR2_HUMAN |
Feature Table for 316-th site |
MUTAGEN: /note="Y->F: Does not inhibit STAT1, STAT2 and STAT3 activation by IFN. Inhibits STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-306; F- 318; F-337; F-411 and F-512. Inhibits STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-306; F-318; F-411 and F-512. Does not inhibit STAT1, STAT2 and STAT3 activation by IFN; when associated with F-512. Does not inhibit STAT1, STAT2 and STAT3 activation by IFN; when associated with F-269; F-306; F-318 and F-337." ECO:0000269|PubMed:12105218" VAR_SEQ: /note="NFHNFLAWPFPNLPPLEAMDMVEVIYINRKKKVWDYNYDDESDSDTEAAPR -> RQGLAKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD (in isoform 2)" ECO:0000303|PubMed:8181059, ECO:0000303|Ref.8" /id="VSP_001738" TOPO_DOM: /note="Cytoplasmic" VAR_SEQ: /note="Missing (in isoform 3)" ECO:0000303|PubMed:7759950" /id="VSP_001737" CHAIN: /note="Interferon alpha/beta receptor 2" /id="PRO_0000011006" |
Percentages of Amino Acids in Homologous Proteins
![]() |
Y:100% |
![]() [Back to SiteTable] |
![]() [Back to Search Page] |
![]() [Back to Top Page] |