Summary for the 1556-th Site(L) |
PID | QueryLength | FocusSite | TITLE |
2900190 | 1817 | 1556 L | RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor; |
AC/ID | AC:P52948 ID:NUP98_HUMAN |
Feature Table for 1556-th site |
VAR_SEQ: /note="RHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYA GQLESEGLWEWAIFVLLHIDNSG -> S (in isoform 2)" /id="VSP_007944" VAR_SEQ: /note="Missing (in isoform 3 and isoform 4)" ECO:0000303|PubMed:8563754, ECO:0000303|Ref.2" /id="VSP_007943" CHAIN: /note="Nuclear pore complex protein Nup96" /id="PRO_0000019930" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
L:100% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
7r5j | H (alpha-helix) | b (buried) | 0.0 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |