Summary for the 1177-th Site(F) |
PID | QueryLength | FocusSite | TITLE |
2900190 | 1817 | 1177 F | RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor; |
AC/ID | AC:P52948 ID:NUP98_HUMAN |
Feature Table for 1177-th site |
VAR_SEQ: /note="WSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMA LFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKP -> C (in isoform 6)" /id="VSP_038328" VAR_SEQ: /note="Missing (in isoform 3 and isoform 4)" ECO:0000303|PubMed:8563754, ECO:0000303|Ref.2" /id="VSP_007943" CHAIN: /note="Nuclear pore complex protein Nup96" /id="PRO_0000019930" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
F:51% K:21% Y:12% L:2% A:1% R:1% N:1% D:1% Q:1% E:1% G:1% I:1% P:1% S:1% T:1% V:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
5a9q | E (beta-strand) | e (exposed) | 36.4 |
Predicted Bind Molecules |
hetero:32 |
Templates for 3D complexes |
hetero [72606:SEC13_HUMAN ] 5a9q_F_1_G_1 5a9q_F_2_G_2 5a9q_F_3_G_3 5a9q_F_4_G_4 5a9q_F_5_G_5 5a9q_F_6_G_6 5a9q_F_7_G_7 5a9q_F_8_G_8 5a9q_GA_1_HA_1 5a9q_GA_2_HA_2 5a9q_GA_3_HA_3 5a9q_GA_4_HA_4 5a9q_GA_5_HA_5 5a9q_GA_6_HA_6 5a9q_GA_7_HA_7 5a9q_GA_8_HA_8 5a9q_O_1_P_1 5a9q_O_2_P_2 5a9q_O_3_P_3 5a9q_O_4_P_4 5a9q_O_5_P_5 5a9q_O_6_P_6 5a9q_O_7_P_7 5a9q_O_8_P_8 5a9q_X_1_Y_1 5a9q_X_2_Y_2 5a9q_X_3_Y_3 5a9q_X_4_Y_4 5a9q_X_5_Y_5 5a9q_X_6_Y_6 5a9q_X_7_Y_7 5a9q_X_8_Y_8 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |