|
|
| PID | QueryLength | FocusSite | TITLE |
| 2900190 | 1817 | 1574 N | RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor; |
| AC/ID | AC:P52948 ID:NUP98_HUMAN |
| Feature Table for 1574-th site |
VAR_SEQ: /note="RHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYA GQLESEGLWEWAIFVLLHIDNSG -> S (in isoform 2)" /id="VSP_007944" VAR_SEQ: /note="Missing (in isoform 3 and isoform 4)" ECO:0000303|PubMed:8563754, ECO:0000303|Ref.2" /id="VSP_007943" CHAIN: /note="Nuclear pore complex protein Nup96" /id="PRO_0000019930" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
D:39% N:26% Q:22% H:13% |
| Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
 7r5k |
(coil) | e (exposed) | 55.8 |
| Predicted Bind Molecules |
| hetero:27 |
| Templates for 3D complexes |
|
hetero [67931:SEC13_YEAST
] 3iko_E_1_D_1 3iko_H_1_G_1 7n9f_MA_1_NA_1 7n9f_MA_2_NA_2 7n9f_MA_3_NA_3 7n9f_MA_4_NA_4 7n9f_MA_5_NA_5 7n9f_MA_6_NA_6 7n9f_MA_7_NA_7 7n9f_MA_8_NA_8 7n9f_MA_P_NA_P 7n9f_YA_1_ZA_1 7n9f_YA_2_ZA_2 7n9f_YA_3_ZA_3 7n9f_YA_4_ZA_4 7n9f_YA_5_ZA_5 7n9f_YA_6_ZA_6 7n9f_YA_7_ZA_7 7n9f_YA_8_ZA_8 7n9f_YA_P_ZA_P [70790:Q7ZYJ8_XENLA
] 7tdz_AA_1_G_1 7tdz_BA_1_F_1 7vci_F_1_G_1 7vci_O_1_P_1 7vop_F_1_G_1 7vop_O_1_P_1 7wb4_M_1_L_1
|
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 1574-th Site(N)