Summary for the 1515-th Site(I) |
PID | QueryLength | FocusSite | TITLE |
2900190 | 1817 | 1515 I | RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor; |
AC/ID | AC:P52948 ID:NUP98_HUMAN |
Feature Table for 1515-th site |
VAR_SEQ: /note="RHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYA GQLESEGLWEWAIFVLLHIDNSG -> S (in isoform 2)" /id="VSP_007944" VAR_SEQ: /note="Missing (in isoform 3 and isoform 4)" ECO:0000303|PubMed:8563754, ECO:0000303|Ref.2" /id="VSP_007943" CHAIN: /note="Nuclear pore complex protein Nup96" /id="PRO_0000019930" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
I:27% A:25% R:14% S:14% H:11% N:1% D:1% Q:1% E:1% G:1% L:1% K:1% P:1% T:1% V:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
7r5k | T (Hbond turn) | b (buried) | 1.8 |
Predicted Bind Molecules |
hetero:5 |
Templates for 3D complexes |
hetero [72240:SEC13_HUMAN ] 3bg0_B_1_E_1 3bg0_F_1_A_1 3bg1_B_1_E_1 [70790:Q7ZYJ8_XENLA ] 6lk8_G_1_H_1 [67931:SEC13_YEAST ] 8tie_J_1_K_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |