|
|
| PID | QueryLength | FocusSite | TITLE |
| 2900190 | 1817 | 1138 F | RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor; |
| AC/ID | AC:P52948 ID:NUP98_HUMAN |
| Feature Table for 1138-th site |
VAR_SEQ: /note="WSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMA LFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKP -> C (in isoform 6)" /id="VSP_038328" VAR_SEQ: /note="Missing (in isoform 3 and isoform 4)" ECO:0000303|PubMed:8563754, ECO:0000303|Ref.2" /id="VSP_007943" CHAIN: /note="Nuclear pore complex protein Nup96" /id="PRO_0000019930" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
F:61% V:21% Y:18% |
| Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
 7r5k |
H (alpha-helix) | e (exposed) | 39.7 |
| Predicted Bind Molecules |
| hetero:7 |
| Templates for 3D complexes |
|
hetero [103327:Q642R6_XENLA
] 6lk8_G_1_A_1 [102635 ] 7fik_G_1_E_1 [102598 ] 7vci_F_1_D_1 7vci_O_1_M_1 7vop_F_1_D_1 7vop_O_1_M_1 [71198:Q7ZYJ8_XENLA
] 7vop_O_1_P_1
|
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 1138-th Site(F)