Summary for the 1575-th Site(S) |
PID | QueryLength | FocusSite | TITLE |
2900190 | 1817 | 1575 S | RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor; |
AC/ID | AC:P52948 ID:NUP98_HUMAN |
Feature Table for 1575-th site |
VAR_SEQ: /note="RHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYA GQLESEGLWEWAIFVLLHIDNSG -> S (in isoform 2)" /id="VSP_007944" VAR_SEQ: /note="Missing (in isoform 3 and isoform 4)" ECO:0000303|PubMed:8563754, ECO:0000303|Ref.2" /id="VSP_007943" CHAIN: /note="Nuclear pore complex protein Nup96" /id="PRO_0000019930" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
D:26% S:26% P:25% V:12% Q:11% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
7r5j | H (alpha-helix) | e (exposed) | 24.2 |
Predicted Bind Molecules |
hetero:6 |
Templates for 3D complexes |
hetero [72460:Q7ZYJ8_XENLA ] 7tdz_AA_1_G_1 7tdz_BA_1_F_1 7vci_F_1_G_1 7vci_O_1_P_1 7vop_F_1_G_1 7vop_O_1_P_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |