Summary for the 1186-th Site(V) |
PID | QueryLength | FocusSite | TITLE |
2900190 | 1817 | 1186 V | RecName: Full=Nuclear pore complex protein Nup98-Nup96 ; EC=3.4.21.- ;Contains: RecName: Full=Nuclear pore complex protein Nup98; AltName: Full=98 kDa nucleoporin; AltName: Full=Nucleoporin Nup98; Short=Nup98;Contains: RecName: Full=Nuclear pore complex protein Nup96; AltName: Full=96 kDa nucleoporin; AltName: Full=Nucleoporin Nup96; Short=Nup96;Flags: Precursor; |
AC/ID | AC:P52948 ID:NUP98_HUMAN |
Feature Table for 1186-th site |
VAR_SEQ: /note="WSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMA LFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKP -> C (in isoform 6)" /id="VSP_038328" VAR_SEQ: /note="Missing (in isoform 3 and isoform 4)" ECO:0000303|PubMed:8563754, ECO:0000303|Ref.2" /id="VSP_007943" CHAIN: /note="Nuclear pore complex protein Nup96" /id="PRO_0000019930" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
V:45% Q:21% A:19% L:2% R:1% N:1% D:1% E:1% G:1% I:1% K:1% F:1% P:1% S:1% T:1% Y:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
7vci | (coil) | e (exposed) | 58.9 |
Predicted Bind Molecules |
hetero:4 |
Templates for 3D complexes |
hetero [72460:Q7ZYJ8_XENLA ] 7vci_F_1_G_1 [105278:Q642R6_XENLA ] 7vci_O_1_S_1 7vop_O_1_T_1 [104517:A0A6I8QA34_XENTR ] 7vop_O_1_M_1 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |