Summary for the 34-th Site(S)
PID QueryLength FocusSite TITLE
2727836 179 34 S RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ;
UniProt Information
AC/IDAC:Q13241 ID:KLRD1_HUMAN
Feature Table for 34-th site VAR_SEQ: /note="MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS -> MAA (in isoform 3)" /id="VSP_003052"
TOPO_DOM: /note="Extracellular"
CHAIN: /note="Natural killer cells antigen CD94" /id="PRO_0000046587"
Evolutionary Information
Percentages of Amino Acids in Homologous Proteins [show alignment] 
S:24% L:22% T:19% A:6% N:4% E:4% G:4% H:4% I:3% C:2% F:2% W:2% V:2% P:1%


[Back to SiteTable]
[Back to Search Page]
[Back to Top Page]