|
|
| PID | QueryLength | FocusSite | TITLE |
| 2727836 | 179 | 1 M | RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ; |
| AC/ID | AC:Q13241 ID:KLRD1_HUMAN |
| Feature Table for 1-th site |
TOPO_DOM: /note="Cytoplasmic" VAR_SEQ: /note="MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS -> MAA (in isoform 3)" /id="VSP_003052" CHAIN: /note="Natural killer cells antigen CD94" /id="PRO_0000046587" |
Percentages of Amino Acids in Homologous Proteins
 [show alignment]
|
M:100% |
 [Back to SiteTable] |
 [Back to Search Page] |
 [Back to Top Page] |
Summary for the 1-st Site(M)