Summary for the 32-nd Site(K)

PID QueryLength FocusSite TITLE
2727836 179 32 K RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ;
UniProt Information
AC/IDAC:Q13241 ID:KLRD1_HUMAN
Feature Table for 32-th site VAR_SEQ: /note="MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS -> MAA (in isoform 3)" /id="VSP_003052"
TOPO_DOM: /note="Extracellular"
CHAIN: /note="Natural killer cells antigen CD94" /id="PRO_0000046587"
Evolutionary Information
Percentages of Amino Acids in Homologous Proteins [show alignment]
K:20% P:17% V:10% R:8% Q:8% N:6% G:6% S:5% T:5% L:3% A:2% C:2% E:2% I:2% W:2% 
3D Structure Information
Template For Monomer predicted SecStr predicted ExpBur Predicted Relative Acc(%)
8tm2 E (beta-strand) b (buried) 5.4


[Back to SiteTable]

[Back to Search Page]

[Back to Top Page]