Summary for the 25-th Site(S) |
PID | QueryLength | FocusSite | TITLE |
2727836 | 179 | 25 S | RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ; |
AC/ID | AC:Q13241 ID:KLRD1_HUMAN |
Feature Table for 25-th site |
VARIANT: /note="S -> A (in dbSNP:rs10772256)" ECO:0000269|PubMed:7589107, ECO:0000269|PubMed:9472066" /id="VAR_050103" TRANSMEM: /note="Helical; Signal-anchor for type II membrane protein" VAR_SEQ: /note="MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS -> MAA (in isoform 3)" /id="VSP_003052" CHAIN: /note="Natural killer cells antigen CD94" /id="PRO_0000046587" |
VARIANT for 25-th site |
S->A LB/B dbSNP:rs1077225 " -" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
V:21% A:20% S:15% T:15% G:6% I:6% F:6% C:5% K:4% M:3% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |