Summary for the 20-th Site(C) |
PID | QueryLength | FocusSite | TITLE |
2727836 | 179 | 20 C | RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ; |
AC/ID | AC:Q13241 ID:KLRD1_HUMAN |
Feature Table for 20-th site |
TRANSMEM: /note="Helical; Signal-anchor for type II membrane protein" VAR_SEQ: /note="MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS -> MAA (in isoform 3)" /id="VSP_003052" CHAIN: /note="Natural killer cells antigen CD94" /id="PRO_0000046587" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
C:60% L:15% V:9% I:5% A:3% G:3% S:3% F:2% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |