Summary for the 33-rd Site(N)

PID QueryLength FocusSite TITLE
2727836 179 33 N RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ;
UniProt Information
AC/IDAC:Q13241 ID:KLRD1_HUMAN
Feature Table for 33-th site VAR_SEQ: /note="MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS -> MAA (in isoform 3)" /id="VSP_003052"
TOPO_DOM: /note="Extracellular"
CHAIN: /note="Natural killer cells antigen CD94" /id="PRO_0000046587"
Evolutionary Information
Percentages of Amino Acids in Homologous Proteins [show alignment]
N:20% L:13% S:11% K:9% V:9% H:7% A:5% D:5% E:4% R:3% Q:3% I:3% F:3% T:3% G:1% 
3D Structure Information
Template For Monomer predicted SecStr predicted ExpBur Predicted Relative Acc(%)
8tm2 T (Hbond turn) b (buried) 6.2


[Back to SiteTable]

[Back to Search Page]

[Back to Top Page]