Summary for the 32-nd Site(K) |
PID | QueryLength | FocusSite | TITLE |
2727836 | 179 | 32 K | RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ; |
AC/ID | AC:Q13241 ID:KLRD1_HUMAN |
Feature Table for 32-th site |
VAR_SEQ: /note="MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNS -> MAA (in isoform 3)" /id="VSP_003052" TOPO_DOM: /note="Extracellular" CHAIN: /note="Natural killer cells antigen CD94" /id="PRO_0000046587" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
K:20% P:17% V:10% R:8% Q:8% N:6% G:6% S:5% T:5% L:3% A:2% C:2% E:2% I:2% W:2% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
8tm2 | E (beta-strand) | b (buried) | 5.4 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |