Summary for the 8-th Site(T) |
PID | QueryLength | FocusSite | TITLE |
20585 | 425 | 8 T | RecName: Full=Mothers against decapentaplegic homolog 3; Short=MAD homolog 3; Short=Mad3; Short=Mothers against DPP homolog 3; Short=hMAD-3;AltName: Full=JV15-2;AltName: Full=SMAD family member 3; Short=SMAD 3; Short=Smad3; Short=hSMAD3; |
AC/ID | AC:P84022 ID:SMAD3_HUMAN |
Feature Table for 8-th site |
MOD_RES: /note="Phosphothreonine; by CDK2 and CDK4" MUTAGEN: /note="T->V: Reduced phosphorylation, increased transcriptional and antiproliferative activities. Further increase in transcriptional and antiproliferative activities; when associated with V-179 and A-213." VAR_SEQ: /note="MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELE KAITTQNVNTKCITIP -> MSCLHPRQTWKGAALVHRKAWWMG (in isoform 2)" /id="VSP_042900" VAR_SEQ: /note="Missing (in isoform 3)" /id="VSP_043793" VAR_SEQ: /note="Missing (in isoform 4)" /id="VSP_045348" CHAIN: /note="Mothers against decapentaplegic homolog 3" /id="PRO_0000090856" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
T:79% H:21% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
1ozj | (coil) | e (exposed) | 30.5 |
Predicted Bind Molecules |
homo:1 |
Templates for 3D complexes |
homo [31770:SMAD5_HUMAN ] 6fzs_A_1_B_2 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |