Summary for the 44-th Site(L)

PID QueryLength FocusSite TITLE
1956853 63 44 L RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3;
UniProt Information
AC/IDAC:P59634 ID:NS6_SARS
Feature Table for 44-th site VARIANT: /note="IISSIVRQLFKPLTKKNYSELDDEEPMELDYP -> NKFNSETII (in strain: Isolate TWJ)"
CHAIN: /note="ORF6 protein" /id="PRO_0000106134"
Evolutionary Information
Percentages of Amino Acids in Homologous Proteins [show alignment]
L:100% 


[Back to SiteTable]

[Back to Search Page]

[Back to Top Page]