Summary for the 243-rd Site(H) |
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 243 H | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 243-th site |
TURN: VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
H:28% E:21% S:15% R:9% Y:8% A:2% G:2% L:2% V:2% N:1% D:1% Q:1% I:1% K:1% M:1% F:1% P:1% T:1% |
Template For Monomer | predicted SecStr | predicted ExpBur | Predicted Relative Acc(%) |
3dsh | T (Hbond turn) | e (exposed) | 78.5 |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |