Summary for the 226-th Site(S) |
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 226 S | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 226-th site |
VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
S:16% Q:15% C:12% A:10% P:10% E:9% N:8% L:8% G:2% V:2% R:1% D:1% H:1% I:1% K:1% M:1% F:1% T:1% Y:1% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |