Summary for the 224-th Site(P) |
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 224 P | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 224-th site |
VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
P:35% Y:12% E:9% T:9% K:8% A:7% S:7% G:2% L:2% V:2% R:1% N:1% D:1% Q:1% H:1% I:1% M:1% F:1% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |