Summary for the 214-th Site(L) |
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 214 L | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 214-th site |
VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
L:26% E:14% A:12% Y:10% F:7% G:3% K:3% S:3% T:3% V:3% R:2% N:2% D:2% Q:2% I:2% P:2% C:1% H:1% M:1% W:1% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |