Summary for the 205-th Site(G) |
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 205 G | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 205-th site |
COMPBIAS: /note="Pro residues" REGION: /note="Disordered" VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
G:50% E:11% N:7% C:6% L:3% A:2% R:2% D:2% I:2% K:2% P:2% S:2% T:2% V:2% Q:1% H:1% M:1% F:1% Y:1% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |