|
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 207 P | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 207-th site |
REGION: /note="Disordered" VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins
![]() |
P:25% H:12% D:10% T:10% A:8% N:7% Y:7% L:3% R:2% E:2% G:2% I:2% K:2% S:2% V:2% C:1% Q:1% M:1% F:1% |
![]() [Back to SiteTable] |
![]() [Back to Search Page] |
![]() [Back to Top Page] |