Summary for the 217-th Site(V) |
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 217 V | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 217-th site |
VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
V:25% A:12% C:12% Q:10% L:10% E:3% G:3% S:3% T:3% R:2% N:2% D:2% I:2% K:2% F:2% P:2% H:1% M:1% W:1% Y:1% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |