|
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 200 L | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 200-th site |
COMPBIAS: /note="Pro residues" REGION: /note="Disordered" VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins
![]() |
L:43% S:15% Q:9% T:9% D:6% M:6% V:6% A:1% R:1% E:1% G:1% I:1% K:1% P:1% |
![]() [Back to SiteTable] |
![]() [Back to Search Page] |
![]() [Back to Top Page] |