Summary for the 191-st Site(G) |
PID | QueryLength | FocusSite | TITLE |
1682730 | 498 | 191 G | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
AC/ID | AC:Q13568 ID:IRF5_HUMAN |
Feature Table for 191-th site |
COMPBIAS: /note="Pro residues" REGION: /note="Disordered" VAR_SEQ: /note="EDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRE LLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPL -> V (in isoform 5)" /id="VSP_044822" VAR_SEQ: /note="Missing (in isoform 6)" /id="VSP_053331" CHAIN: /note="Interferon regulatory factor 5" /id="PRO_0000154558" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
G:21% S:17% A:14% N:13% H:12% Q:7% V:7% R:1% D:1% E:1% I:1% L:1% K:1% F:1% P:1% T:1% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |