Summary for the 954-th Site(Q)

PID QueryLength FocusSite TITLE
15534 1170 954 Q RecName: Full=Integrin alpha-L ;AltName: Full=CD11 antigen-like family member A;AltName: Full=Leukocyte adhesion glycoprotein LFA-1 alpha chain; Short=LFA-1A;AltName: Full=Leukocyte function-associated molecule 1 alpha chain;AltName: CD_antigen=CD11a;Flags: Precursor;
UniProt Information
AC/IDAC:P20701 ID:ITAL_HUMAN
Feature Table for 954-th site VAR_SEQ: /note="Q -> QGVHGLVEMQTSKQILCRPAGDAEHTVGAQEGELPCPWGVSEAFRDN IRAGPCR (in isoform 2)" /id="VSP_002738"
TOPO_DOM: /note="Extracellular"
CHAIN: /note="Integrin alpha-L" /id="PRO_0000016292"
Evolutionary Information
Percentages of Amino Acids in Homologous Proteins [show alignment]
Q:31% E:22% R:10% L:10% S:7% T:7% G:6% I:5% 
3D Structure Information
Template For Monomer predicted SecStr predicted ExpBur Predicted Relative Acc(%)
3k71 E (beta-strand) e (exposed) 20.9


[Back to SiteTable]

[Back to Search Page]

[Back to Top Page]