Summary for the 1-st Site(M) |
PID | QueryLength | FocusSite | TITLE |
11199 | 492 | 1 M | RecName: Full=Transmembrane protease serine 2 ; EC=3.4.21.122 ;AltName: Full=Serine protease 10 ;Contains: RecName: Full=Transmembrane protease serine 2 non-catalytic chain;Contains: RecName: Full=Transmembrane protease serine 2 catalytic chain;Flags: Precursor; |
AC/ID | AC:O15393 ID:TMPS2_HUMAN |
Feature Table for 1-th site |
VAR_SEQ: /note="M -> MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKM (in isoform 2)" /id="VSP_045083" TOPO_DOM: /note="Cytoplasmic" CHAIN: /note="Transmembrane protease serine 2 non-catalytic chain" /id="PRO_0000027855" |
Percentages of Amino Acids in Homologous Proteins [show alignment] |
M:100% |
[Back to SiteTable] |
[Back to Search Page] |
[Back to Top Page] |