#WARNING:no index is registered index "YP_009724395.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724395.1.txt". 
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.
type	start	end	name	pdb_id	identity	asym_id_homo	oper_homo	auth_asym_id_homo	mol_id_homo	asym_id_con	oper_con	auth_asym_id_con	mol_id_con	sites	description_homo	description_con
#WARNING:no index is registered index "YP_009724395.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724395.1.txt". 
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.
length	1	121
id	1	121	query
title	1	121	
seq	1	121	MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
disorder	1	10	predicted_by_DISOPRED
disorder	121	121	predicted_by_DISOPRED
pdb_monomer	16	98	monomer	1yo4	91.6	A		A	YX4_CVHSA					16-98