#WARNING:no index is registered index "YP_009724392.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724392.1.txt". 
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.
type	start	end	name	pdb_id	identity	asym_id_homo	oper_homo	auth_asym_id_homo	mol_id_homo	asym_id_con	oper_con	auth_asym_id_con	mol_id_con	sites	description_homo	description_con
#WARNING:no index is registered index "YP_009724392.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724392.1.txt". 
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.
length	1	75
id	1	75	query
title	1	75	
seq	1	75	MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
pdb_monomer	8	38	monomer	8suz	100.0	E		E	VEMP_SARS2					8-38	
pdb_complex	8	38	homo	7k3g	100.0	A	1	A	VEMP_SARS2	B	1	B	VEMP_SARS2	 11:14:15:17:18:20:21:24:27:28:31:35	Envelope small membrane protein	Envelope small membrane protein[31 aa]