type	start	end	name	pdb_id	identity	asym_id_homo	oper_homo	auth_asym_id_homo	mol_id_homo	asym_id_con	oper_con	auth_asym_id_con	mol_id_con	sites	description_homo	description_con
length	1	468
id	1	468	IL6RA_HUMAN
title	1	468	RecName: Full=Interleukin-6 receptor subunit alpha ;         Short=IL-6 receptor subunit alpha;         Short=IL-6R subunit alpha;         Short=IL-6R-alpha;         Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80;         Short=gp80;AltName: CD_antigen=CD126;Contains:  RecName: Full=Soluble interleukin-6 receptor subunit alpha ;           Short=sIL6R ;Flags: Precursor;
seq	1	468	MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
uniprot	1	19	SIGNAL										
uniprot	20	468	CHAIN										/note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895"
uniprot	20	355	CHAIN										/note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730"
uniprot	20	365	TOPO_DOM										/note="Extracellular"
uniprot	366	386	TRANSMEM										/note="Helical"
uniprot	387	468	TOPO_DOM										/note="Cytoplasmic"
uniprot	26	112	DOMAIN										/note="Ig-like C2-type"
uniprot	113	217	DOMAIN										/note="Fibronectin type-III 1"
uniprot	218	316	DOMAIN										/note="Fibronectin type-III 2"
uniprot	303	328	REGION										/note="Disordered"
uniprot	421	468	REGION										/note="Disordered"
uniprot	311	328	COMPBIAS										/note="Polar residues"
disorder	1	18	predicted_by_DISOPRED
disorder	313	331	predicted_by_DISOPRED
disorder	333	334	predicted_by_DISOPRED
disorder	341	354	predicted_by_DISOPRED
disorder	356	356	predicted_by_DISOPRED
disorder	358	358	predicted_by_DISOPRED
disorder	406	413	predicted_by_DISOPRED
disorder	420	468	predicted_by_DISOPRED
pdb_monomer	20	318	monomer	1n26	100.0	A		A	IL6A_HUMAN					20-318	
pdb_complex	115	315	hetero	1p9m	100.0	C	1	C	IL6RA_HUMAN	A	1	A	IL6RB_HUMAN	 232:233:257:261-264:266:271:280:281:283	Interleukin-6 receptor alpha chain	Interleukin-6 receptor beta chain[298 aa]
pdb_complex	115	315	hetero	1p9m	100.0	C	1	C	IL6RA_HUMAN	A	2	A	IL6RB_HUMAN	 151:153:154:156-158:187:207	Interleukin-6 receptor alpha chain	Interleukin-6 receptor beta chain[298 aa]
pdb_complex	115	315	hetero	1p9m	100.0	C	1	C	IL6RA_HUMAN	B	1	B	IL6_HUMAN	 127:181-183:187:209:212:247-250:296-298:300	Interleukin-6 receptor alpha chain	Interleukin-6[163 aa]
pdb_complex	23	318	hetero	8d82	100.0	A	1	C	IL6RA_HUMAN	B	1	D	IL6_HUMAN	 127:155:182:183:187:248-250:296-298:300	Soluble interleukin-6 receptor subunit alpha	Interleukin-6[169 aa]
pdb_complex	115	315	hetero	8qy5	100.0	C	1	C	IL6RA_HUMAN	B	1	B	IL6_HUMAN	 127:155:182:183:187:246:248-250:297:298	Interleukin-6 receptor subunit alpha	Interleukin-6[157 aa]
pdb_complex	23	318	hetero	8d82	100.0	A	1	C	IL6RA_HUMAN	C	1	A	IL6RB_HUMAN	 232:233:261:262:264:266:268:271:280:281:283	Soluble interleukin-6 receptor subunit alpha	Interleukin-6 receptor subunit beta[589 aa]
pdb_complex	23	318	hetero	8d82	100.0	A	1	C	IL6RA_HUMAN	F	1	E	IL6RB_HUMAN	 155:157:187:189:205:207	Soluble interleukin-6 receptor subunit alpha	Interleukin-6 receptor subunit beta[589 aa]
pdb_complex	209	312	hetero	8iow	100.0	A	1	I	IL6RA_HUMAN	C	1	L		 252:253:269:298:299:303	Interleukin-6 receptor subunit alpha	Light chain of Sarilumab Fab[212 aa]
pdb_complex	209	312	hetero	8iow	100.0	A	1	I	IL6RA_HUMAN	D	1	H		 248-250:252:270-273:296-299	Interleukin-6 receptor subunit alpha	Heavy chain of Sarilumab Fab[207 aa]
pdb_complex	215	309	hetero	8j6f	100.0	C	1	I	IL6RA_HUMAN	A	1	H		 248-252:270-273:275:296-298:300	Interleukin-6 receptor subunit alpha	Heavy chain of Tocilizumab Fab[211 aa]
pdb_complex	215	309	hetero	8j6f	100.0	C	1	I	IL6RA_HUMAN	D	1	B	IL6RA_HUMAN	 215:217:243-245:249	Interleukin-6 receptor subunit alpha	IL6R-D2 peptide[10 aa]
pdb_complex	115	315	hetero	8qy5	100.0	C	1	C	IL6RA_HUMAN	A	1	A	IL6RB_MOUSE	 232:233:261:262:265:266:268:269:271:280-284	Interleukin-6 receptor subunit alpha	Interleukin-6 receptor subunit beta[584 aa]
pdb_complex	115	315	hetero	8qy5	100.0	C	1	C	IL6RA_HUMAN	F	1	D	IL6RB_MOUSE	 151:153:155:157:158:189:205:207	Interleukin-6 receptor subunit alpha	Interleukin-6 receptor subunit beta[584 aa]
pdb_complex	20	318	compound	1n26	100.0	A	1	A	IL6A_HUMAN	D	1	A	NAG	 220:221:239:240:242	IL-6 Receptor alpha chain	2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
pdb_complex	20	318	compound	1n26	100.0	A	1	A	IL6A_HUMAN	E	1	A	NAG	 53-55	IL-6 Receptor alpha chain	2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
pdb_complex	20	318	compound	1n26	100.0	A	2	A	IL6A_HUMAN	E	1	A	NAG	 309-311	IL-6 Receptor alpha chain	2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
pdb_complex	23	318	compound	8d82	100.0	A	1	C	IL6RA_HUMAN	S	1	C	NAG	 63:93:107	Soluble interleukin-6 receptor subunit alpha	2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
pdb_complex	209	312	compound	8iow	100.0	A	1	I	IL6RA_HUMAN	F	1	I	NAG	 245:248:249	Interleukin-6 receptor subunit alpha	2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
pdb_complex	20	318	compound	1n26	100.0	A	1	A	IL6A_HUMAN	H	1	A	CYS	 183-185:209:211	IL-6 Receptor alpha chain	CYSTEINE[7 atoms]
pdb_complex	20	318	otherpoly	1n26	100.0	A	1	A	IL6A_HUMAN	B	1	B		 128:129:131:163:164:166:177:245:246	IL-6 Receptor alpha chain	2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al..
pdb_complex	20	318	otherpoly	1n26	100.0	A	1	A	IL6A_HUMAN	C	1	C		 63-65:93:107	IL-6 Receptor alpha chain	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..
pdb_complex	23	318	otherpoly	8d82	100.0	A	1	C	IL6RA_HUMAN	G	1	B		 245	Soluble interleukin-6 receptor subunit alpha	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..
pdb_complex	20	318	homo	1n26	100.0	A	1	A	IL6A_HUMAN	A	2	A	IL6A_HUMAN	 59:73-75:77:80-84:90	IL-6 Receptor alpha chain	IL-6 Receptor alpha chain[299 aa]
pdb_complex	20	318	homo	1n26	100.0	A	2	A	IL6A_HUMAN	A	1	A	IL6A_HUMAN	 225-230:233:287:311-313:315-318	IL-6 Receptor alpha chain	IL-6 Receptor alpha chain[299 aa]
pdb_complex	209	312	homo	8iow	100.0	A	1	I	IL6RA_HUMAN	B	1	D2	IL6RA_HUMAN	 213-215:217:243-245:249	Interleukin-6 receptor subunit alpha	Interleukin-6 receptor subunit alpha[14 aa]
pdb_complex	20	318	precipitant	1n26	100.0	A	1	A	IL6A_HUMAN	F	1	A	SO4	 274-276	IL-6 Receptor alpha chain	SULFATE ION[5 atoms]
pdb_complex	20	318	precipitant	1n26	100.0	A	1	A	IL6A_HUMAN	G	1	A	SO4	 115:116:137	IL-6 Receptor alpha chain	SULFATE ION[5 atoms]