#WARNING:no index is registered index "YP_009725304.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725304.1.txt". 
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. type start end name pdb_id identity asym_id_homo oper_homo auth_asym_id_homo mol_id_homo asym_id_con oper_con auth_asym_id_con mol_id_con sites description_homo description_con #WARNING:no index is registered index "YP_009725304.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725304.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. length 1 198 id 1 198 query title 1 198 seq 1 198 AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ disorder 1 4 predicted_by_DISOPRED disorder 197 198 predicted_by_DISOPRED pdb_monomer 6 195 monomer 8gwe 100.0 B B R1AB_SARS2 6-195 pdb_monomer 6 195 monomer 7uo9 100.0 B B R1AB_SARS2 6-195 pdb_monomer 6 193 monomer 7uoe 100.0 B B R1AB_SARS2 6-193 pdb_monomer 6 192 monomer 8gwk 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gw1 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7uo4 100.0 D D R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8sqj 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwo 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwf 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8sqk 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7egq 100.0 J O R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7cxm 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwi 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwg 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwf 100.0 D D R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwe 100.0 D D R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwn 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwi 100.0 D D R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwg 100.0 D D R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7uob 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7cyq 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7cxn 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwm 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 8gwb 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7eiz 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7egq 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7uo4 100.0 B B R1AB_SARS2 6-192 pdb_monomer 6 192 monomer 7dte 100.0 B B R1AB_SARS2 6-192 pdb_monomer 2 192 monomer 2ahm 97.4 H H R1AB_CVHSA 2-192 pdb_monomer 1 191 monomer 2ahm 97.4 G G R1AB_CVHSA 1-191 pdb_monomer 6 191 monomer 8sq9 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 8gwb 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7eiz 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 8sq9 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7egq 100.0 L Q R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7cxm 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 8gwo 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7uo9 100.0 F D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 8gwn 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 8gw1 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7uoe 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7uob 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7uo7 100.0 F D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7uo7 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7cyq 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7cxn 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 8gwk 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 8gwm 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7egq 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7kro 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 6xez 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7krp 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7re3 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7rdz 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7krn 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 6xez 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7re1 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7re2 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7re0 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7re3 100.0 G H R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7rdy 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7rdx 100.0 B B R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 7dte 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 6yyt 100.0 D D R1AB_SARS2 6-191 pdb_monomer 6 191 monomer 6yyt 100.0 B B R1AB_SARS2 6-191 pdb_monomer 7 191 monomer 8sqk 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 8sqj 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7krp 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7kro 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7re2 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7re1 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7re0 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7re3 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7re3 100.0 L J R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7rdy 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7rdz 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7rdx 100.0 D D R1AB_SARS2 7-191 pdb_monomer 7 191 monomer 7krn 100.0 D D R1AB_SARS2 7-191 pdb_monomer 6 191 monomer 7dok 100.0 F G R1AB_SARS2 6-191 pdb_monomer 37 191 monomer 7dok 100.0 D B R1AB_SARS2 37-191 pdb_monomer 38 191 monomer 7ed5 100.0 D D R1AB_SARS2 38-191 pdb_monomer 38 192 monomer 2ahm 97.4 E E R1AB_CVHSA 38-192 pdb_monomer 43 192 monomer 7ed5 100.0 B B R1AB_SARS2 43-192 pdb_monomer 50 192 monomer 2ahm 97.2 F F R1AB_CVHSA 50-192 pdb_monomer 53 191 monomer 7c2k 100.0 D D R1AB_SARS2 53-191 pdb_monomer 67 192 monomer 7btf 100.0 C B R1AB_SARS2 67-192 pdb_monomer 78 198 monomer 6wqd 100.0 B B R1AB_SARS2 78-198 pdb_monomer 76 192 monomer 6yhu 100.0 B B R1A_SARS2 76-192 pdb_monomer 78 194 monomer 6xip 100.0 D D R1AB_SARS2 78-194 pdb_monomer 77 192 monomer 7dcd 100.0 D D R1A_SARS2 77-192 pdb_monomer 77 192 monomer 7dcd 100.0 B B R1A_SARS2 77-192 pdb_monomer 76 191 monomer 6yhu 100.0 D D R1A_SARS2 76-191 pdb_monomer 78 193 monomer 6wtc 100.0 D D R1AB_SARS2 78-193 pdb_monomer 75 191 monomer 7dfg 100.0 D B R1AB_SARS2 75-191 pdb_monomer 79 194 monomer 6wtc 100.0 B B R1AB_SARS2 79-194 pdb_monomer 77 193 monomer 7jlt 100.0 D D R1AB_SARS2 77-193 pdb_monomer 76 192 monomer 7c2k 100.0 B B R1AB_SARS2 76-192 pdb_monomer 77 191 monomer 6wiq 100.0 B B R1AB_SARS2 77-191 pdb_monomer 78 192 monomer 6xip 100.0 B B R1AB_SARS2 78-192 pdb_monomer 77 192 monomer 7jlt 100.0 B B R1AB_SARS2 77-192 pdb_monomer 77 190 monomer 7dcd 100.0 H H R1A_SARS2 77-190 pdb_monomer 78 191 monomer 7l1f 100.0 B C R1AB_SARS2 78-191 pdb_monomer 79 192 monomer 6wqd 100.0 D D R1AB_SARS2 79-192 pdb_monomer 77 191 monomer 6m5i 100.0 A B R1A_SARS2 77-191 pdb_monomer 77 191 monomer 7b3c 100.0 B B R1AB_SARS2 77-191 pdb_monomer 77 191 monomer 7b3b 100.0 B B R1AB_SARS2 77-191 pdb_monomer 77 191 monomer 7b3d 100.0 B B R1AB_SARS2 77-191 pdb_monomer 78 192 monomer 7bw4 100.0 B B R1AB_SARS2 78-192 pdb_monomer 77 191 monomer 7ozv 100.0 B B R1AB_SARS2 77-191 pdb_monomer 77 191 monomer 7ozu 100.0 B B R1AB_SARS2 77-191 pdb_monomer 77 189 monomer 7dcd 100.0 F F R1A_SARS2 77-189 pdb_monomer 78 191 monomer 7aap 100.0 B B R1AB_SARS2 78-191 pdb_monomer 78 191 monomer 7ctt 100.0 B B R1AB_SARS2 78-191 pdb_monomer 78 191 monomer 7d4f 100.0 A B R1AB_SARS2 78-191 pdb_monomer 78 191 monomer 7dfh 100.0 B B R1AB_SARS2 78-191 pdb_monomer 78 191 monomer 7doi 100.0 B B R1AB_SARS2 78-191 pdb_monomer 79 192 monomer 7bzf 100.0 B B R1AB_SARS2 79-192 pdb_monomer 78 191 monomer 7bv1 100.0 B B R1AB_SARS2 78-191 pdb_monomer 78 191 monomer 7bv2 100.0 B B R1AB_SARS2 78-191 pdb_monomer 78 191 monomer 6xqb 100.0 B B R1AB_SARS2 78-191 pdb_monomer 77 191 monomer 5f22 96.5 B B R1AB_CVHSA 77-191 pdb_monomer 78 191 monomer 8gy6 100.0 B B R1AB_SARS2 78-191 pdb_monomer 78 191 monomer 6m71 100.0 D B R1AB_SARS2 78-191 pdb_monomer 77 191 monomer 6nur 96.5 B B R1A_CVHSA 77-191 pdb_monomer 80 191 monomer 6nus 96.4 B B R1A_CVHSA 80-191 pdb_monomer 81 192 monomer 7thm 100.0 B B R1AB_SARS2 81-192 pdb_monomer 84 191 monomer 7doi 100.0 F G R1AB_SARS2 84-191 pdb_monomer 84 191 monomer 7dfg 100.0 F G R1AB_SARS2 84-191 pdb_monomer 84 191 monomer 7d4f 100.0 C G R1AB_SARS2 84-191 pdb_monomer 84 191 monomer 7dfh 100.0 D G R1AB_SARS2 84-191 pdb_monomer 84 192 monomer 6nur 96.3 D D R1A_CVHSA 84-192 pdb_monomer 84 191 monomer 7bzf 100.0 D D R1AB_SARS2 84-191 pdb_monomer 84 191 monomer 7btf 100.0 D D R1AB_SARS2 84-191 pdb_monomer 85 189 monomer 7bv1 100.0 D D R1AB_SARS2 85-189 pdb_monomer 9 190 monomer 8urb 44.0 B B U6BRU0_9ALPC 9-190 pdb_monomer 84 191 monomer 7bw4 100.0 D D R1AB_SARS2 84-191 pdb_monomer 111 191 monomer 7oyg 100.0 B B R1AB_SARS2 111-191 pdb_monomer 111 191 monomer 7oyg 100.0 G E R1AB_SARS2 111-191 pdb_monomer 11 190 monomer 8urb 43.3 D D U6BRU0_9ALPC 11-190 pdb_monomer 1 84 monomer 7ywr 100.0 A A A0A8A0A7W8_SARS2 1-84 pdb_monomer 1 190 monomer 3ub0 43.2 D D R1AB_FIPV 1-190 pdb_monomer 1 190 monomer 3ub0 42.7 A A R1AB_FIPV 1-190 pdb_monomer 84 189 monomer 7thm 100.0 D D R1AB_SARS2 84-189 pdb_monomer 79 190 monomer 8g6r 38.4 B B A0A1Z2R8Q6_9ALPC 79-190 pdb_monomer 84 132 monomer 8gy6 100.0 D D R1AB_SARS2 84-132 pdb_monomer 84 132 monomer 6m71 100.0 C D R1AB_SARS2 84-132 pdb_monomer 84 114 monomer 6xqb 100.0 D D R1AB_SARS2 84-114 pdb_monomer 84 111 monomer 7aap 100.0 D D R1AB_SARS2 84-111 pdb_monomer 84 111 monomer 7ctt 100.0 D D R1AB_SARS2 84-111 pdb_complex 1 190 hetero 3ub0 42.7 A 1 A R1AB_FIPV B 1 B R1AB_FIPV 59:62:63:66:70:73:79:83:86:87:90:94 Non-structural protein 6, nsp6, Non-structural protein 7, nsp7[82 aa] pdb_complex 1 190 hetero 3ub0 42.7 A 1 A R1AB_FIPV C 1 C R1AB_FIPV 79:84:87-100:102:104:106:107:110:111:113:115:116:119-121:149:150:190 Non-structural protein 6, nsp6, Non-structural protein 7, nsp7[82 aa] pdb_complex 1 190 hetero 3ub0 43.2 D 1 D R1AB_FIPV E 1 E R1AB_FIPV 59:62:63:66:70:73:80:83:87:90 Non-structural protein 6, nsp6, Non-structural protein 7, nsp7[81 aa] pdb_complex 1 190 hetero 3ub0 43.2 D 1 D R1AB_FIPV F 1 F R1AB_FIPV 84:85:87-98:100:102:106-108:110:111:115:116:119:121:149-151:190 Non-structural protein 6, nsp6, Non-structural protein 7, nsp7[78 aa] pdb_complex 79 190 hetero 8g6r 38.4 B 1 B A0A1Z2R8Q6_9ALPC A 1 A A0A0U2C263_9ALPC 79:80:83:84:86-88:90-92:94:95:97:98:100:104:106:107:110:111:113-119:121:125:127-131:137:141:143:148-152 nsp8 nsp12[899 aa] pdb_complex 9 190 hetero 8urb 44.0 B 1 B U6BRU0_9ALPC A 1 A U6BRU0_9ALPC 79:80:84:86-88:90-92:94:95:97:98:100:103:104:112:114-121:123:127-132:137:141:143:148-151:162 nsp8 nsp12[921 aa] pdb_complex 11 190 hetero 8urb 43.3 D 1 D U6BRU0_9ALPC A 1 A U6BRU0_9ALPC 64:67:70-72:75:76:79:90:94:97 nsp8 nsp12[921 aa] pdb_complex 79 190 hetero 8g6r 38.4 B 1 B A0A1Z2R8Q6_9ALPC C 1 C A0A0M4AW09_9ALPC 162:163 nsp8 nsp7[62 aa] pdb_complex 9 190 hetero 8urb 44.0 B 1 B U6BRU0_9ALPC C 1 C U6BRU0_9ALPC 162:163:181 nsp8 nsp7[70 aa] pdb_complex 11 190 hetero 8urb 43.3 D 1 D U6BRU0_9ALPC C 1 C U6BRU0_9ALPC 88:91:94-96:98:100:102:103:106-108:116:117:119:121:150-152:190 nsp8 nsp7[70 aa] pdb_complex 80 191 hetero 6nus 96.4 B 1 B R1A_CVHSA A 1 A R1AB_CVHSA 80:83:84:86-88:90:91:94:95:97-99:103:104:109:111-122:124:125:127-131:133:137:141:149:154 NSP8 NSP12[715 aa] pdb_complex 38 192 hetero 2ahm 97.4 E 1 E R1AB_CVHSA A 1 A R1AB_CVHSA 80:83:84:87:88:90-92:94:95:97:98:100:102:103:106:107:110:111:113:116:119:120:122 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 38 192 hetero 2ahm 97.4 E 1 E R1AB_CVHSA A 2 A R1AB_CVHSA 70:72-75 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 38 192 hetero 2ahm 97.4 E 2 E R1AB_CVHSA A 1 A R1AB_CVHSA 70:72-75 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 38 192 hetero 2ahm 97.4 E 2 E R1AB_CVHSA A 2 A R1AB_CVHSA 80:83:84:87:88:90-92:94:95:97:98:100:102:103:106:107:110:111:113:116:119:120:122 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 38 192 hetero 2ahm 97.4 E 1 E R1AB_CVHSA D 1 D R1AB_CVHSA 79:80:82:83:86:87:90:94:96:97 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[76 aa] pdb_complex 38 192 hetero 2ahm 97.4 E 2 E R1AB_CVHSA D 2 D R1AB_CVHSA 79:80:82:83:86:87:90:94:96:97 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[76 aa] pdb_complex 50 192 hetero 2ahm 97.2 F 1 F R1AB_CVHSA B 1 B R1AB_CVHSA 80:83:84:87:88:90-92:94:96-98:100:102:103:106:107:110:111:113:116:119:120:122 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 50 192 hetero 2ahm 97.2 F 1 F R1AB_CVHSA B 2 B R1AB_CVHSA 70:72:74 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 50 192 hetero 2ahm 97.2 F 2 F R1AB_CVHSA B 1 B R1AB_CVHSA 70:72:74 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 50 192 hetero 2ahm 97.2 F 2 F R1AB_CVHSA B 2 B R1AB_CVHSA 80:83:84:87:88:90-92:94:96-98:100:102:103:106:107:110:111:113:116:119:120:122 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 50 192 hetero 2ahm 97.2 F 1 F R1AB_CVHSA C 1 C R1AB_CVHSA 79:80:82:83:87:90 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[74 aa] pdb_complex 50 192 hetero 2ahm 97.2 F 2 F R1AB_CVHSA C 2 C R1AB_CVHSA 79:80:82:83:87:90 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[74 aa] pdb_complex 1 191 hetero 2ahm 97.4 G 1 G R1AB_CVHSA A 2 A R1AB_CVHSA 44:48:51 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 1 191 hetero 2ahm 97.4 G 2 G R1AB_CVHSA A 1 A R1AB_CVHSA 44:48:51 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 1 191 hetero 2ahm 97.4 G 1 G R1AB_CVHSA B 1 B R1AB_CVHSA 79:82:83:86:87:90:94 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 1 191 hetero 2ahm 97.4 G 2 G R1AB_CVHSA B 2 B R1AB_CVHSA 79:82:83:86:87:90:94 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 1 191 hetero 2ahm 97.4 G 1 G R1AB_CVHSA C 1 C R1AB_CVHSA 80:83:84:87:88:91:94:95:98:100:102:103:106:107:110:111:115:116:119:120:122:131 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[74 aa] pdb_complex 1 191 hetero 2ahm 97.4 G 2 G R1AB_CVHSA C 2 C R1AB_CVHSA 80:83:84:87:88:91:94:95:98:100:102:103:106:107:110:111:115:116:119:120:122:131 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[74 aa] pdb_complex 1 191 hetero 2ahm 97.4 G 1 G R1AB_CVHSA D 1 D R1AB_CVHSA 8:60:62:63:66:67:69:70 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[76 aa] pdb_complex 1 191 hetero 2ahm 97.4 G 2 G R1AB_CVHSA D 2 D R1AB_CVHSA 8:60:62:63:66:67:69:70 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[76 aa] pdb_complex 2 192 hetero 2ahm 97.4 H 1 H R1AB_CVHSA A 1 A R1AB_CVHSA 79:82:83:86:87:89:90:94 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 2 192 hetero 2ahm 97.4 H 2 H R1AB_CVHSA A 2 A R1AB_CVHSA 79:82:83:86:87:89:90:94 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 2 192 hetero 2ahm 97.4 H 1 H R1AB_CVHSA B 2 B R1AB_CVHSA 44:48:51 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 2 192 hetero 2ahm 97.4 H 2 H R1AB_CVHSA B 1 B R1AB_CVHSA 44:48:51 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[77 aa] pdb_complex 2 192 hetero 2ahm 97.4 H 1 H R1AB_CVHSA C 1 C R1AB_CVHSA 5:8:59:60:62:63:66:67:70:71 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[74 aa] pdb_complex 2 192 hetero 2ahm 97.4 H 2 H R1AB_CVHSA C 2 C R1AB_CVHSA 5:8:59:60:62:63:66:67:70:71 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[74 aa] pdb_complex 2 192 hetero 2ahm 97.4 H 1 H R1AB_CVHSA D 1 D R1AB_CVHSA 77:80:83:84:87-89:91:92:94:95:98:100:102:103:106:107:110:111:113:115:116:119:120:122 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[76 aa] pdb_complex 2 192 hetero 2ahm 97.4 H 2 H R1AB_CVHSA D 2 D R1AB_CVHSA 77:80:83:84:87-89:91:92:94:95:98:100:102:103:106:107:110:111:113:115:116:119:120:122 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, light chain[76 aa] pdb_complex 77 191 hetero 5f22 96.5 B 1 B R1AB_CVHSA A 1 A R1A_CVHSA 80:83:84:87-92:94:95:97:98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein Non-structural protein 7[79 aa] pdb_complex 77 191 hetero 6m5i 100.0 A 1 B R1A_SARS2 B 1 A R1A_SARS2 77:80:83:84:87-89:91:92:94-96:98:100:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[81 aa] pdb_complex 84 132 hetero 6m71 100.0 C 1 D R1AB_SARS2 B 1 C R1AB_SARS2 87-92:94:95:97:98:100:103:106:110-112:115-117:119:120:122 Non-structural protein 8 Non-structural protein 7[70 aa] pdb_complex 78 191 hetero 6m71 100.0 D 1 B R1AB_SARS2 B 1 C R1AB_SARS2 162:163:178 Non-structural protein 8 Non-structural protein 7[70 aa] pdb_complex 77 191 hetero 6nur 96.5 B 1 B R1A_CVHSA C 1 C R1AB_CVHSA 163:178-181 NSP8 NSP7[70 aa] pdb_complex 84 192 hetero 6nur 96.3 D 1 D R1A_CVHSA C 1 C R1AB_CVHSA 84:87:88:91:92:94-98:100:102:103:106:107:110:111:115-120:122 NSP8 NSP7[70 aa] pdb_complex 77 191 hetero 6wiq 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 77:80:84:87:88:90-92:94-98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[80 aa] pdb_complex 77 191 hetero 6wiq 100.0 B 1 B R1AB_SARS2 A 2 A R1AB_SARS2 82:83:86:87:90:93:94:97 Non-structural protein 8 Non-structural protein 7[80 aa] pdb_complex 77 191 hetero 6wiq 100.0 B 2 B R1AB_SARS2 A 1 A R1AB_SARS2 82:83:86:87:90:93:94:97 Non-structural protein 8 Non-structural protein 7[80 aa] pdb_complex 77 191 hetero 6wiq 100.0 B 2 B R1AB_SARS2 A 2 A R1AB_SARS2 77:80:84:87:88:90-92:94-98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[80 aa] pdb_complex 78 198 hetero 6wqd 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 84:85:87-92:94-98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[74 aa] pdb_complex 78 198 hetero 6wqd 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 79:82:83:86:87:90:93:94:97 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 79 192 hetero 6wqd 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 82:83:86:87:90:93:94:97 Non-structural protein 8 Non-structural protein 7[74 aa] pdb_complex 79 192 hetero 6wqd 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 80:84:85:87-92:94:95:97:98:100:102:103:106:107:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 79 194 hetero 6wtc 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 87-92:94:95:98:100:102:103:106:107:111:115-117:119:120:122:150:194 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 79 194 hetero 6wtc 100.0 B 1 B R1AB_SARS2 C 2 C R1AB_SARS2 79:82:83:86:87:90:93:94:97 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 78 193 hetero 6wtc 100.0 D 2 D R1AB_SARS2 A 1 A R1AB_SARS2 79:82:83:86:87:90:93:94:97 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 78 193 hetero 6wtc 100.0 D 2 D R1AB_SARS2 C 2 C R1AB_SARS2 80:87-92:94:95:98:100:102:103:106:107:110:111:115:116:119:120:122:150 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 6xez 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 163:178 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 6xez 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 87:90-92:94:98:100:103:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 78 192 hetero 6xip 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:84:87:88:90-92:94:95:97:98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 78 192 hetero 6xip 100.0 B 1 B R1AB_SARS2 C 2 C R1AB_SARS2 82:83:86:87:90:93:94:97 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 78 194 hetero 6xip 100.0 D 2 D R1AB_SARS2 A 1 A R1AB_SARS2 82:83:86:87:90:93:94:97 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 78 194 hetero 6xip 100.0 D 2 D R1AB_SARS2 C 2 C R1AB_SARS2 84:87-92:94:95:98:100:102:103:106:107:110:111:115-117:119:120:122:150:194 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 84 114 hetero 6xqb 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 84:87:88:90:91:94:95:97:98:100:103:106:110 Non-structural protein 8 Non-structural protein 7[62 aa] pdb_complex 76 192 hetero 6yhu 100.0 B 1 B R1A_SARS2 A 1 A R1A_SARS2 84:85:87-92:94-96:98:100:102:103:106:107:110:111:115-117:119:120:122:190 Replicase polyprotein 1a Replicase polyprotein 1a[71 aa] pdb_complex 76 191 hetero 6yhu 100.0 D 1 D R1A_SARS2 C 1 C R1A_SARS2 80:85:87-92:94-98:100:102:103:106:107:110:111:115:116:119:120:122 Replicase polyprotein 1a Replicase polyprotein 1a[71 aa] pdb_complex 6 191 hetero 6yyt 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:179 nsp8 nsp7[73 aa] pdb_complex 6 191 hetero 6yyt 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87-89:91:92:94:95:98:100:102:103:106:107:110:111:115-120:122 nsp8 nsp7[73 aa] pdb_complex 78 191 hetero 7aap 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178 Non-structural protein 8 Non-structural protein 7[67 aa] pdb_complex 84 111 hetero 7aap 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 84:88:90-92:94:95:98:100:102:103:106:107:110 Non-structural protein 8 Non-structural protein 7[67 aa] pdb_complex 77 191 hetero 7b3b 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163 Non-structural protein 8 Non-structural protein 7[62 aa] pdb_complex 77 191 hetero 7b3c 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178-180 Non-structural protein 8 Non-structural protein 7[62 aa] pdb_complex 77 191 hetero 7b3d 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:179 SARS-CoV-2 nsp8 SARS-CoV-2 nsp7[62 aa] pdb_complex 67 192 hetero 7btf 100.0 C 1 B R1AB_SARS2 B 1 C R1AB_SARS2 162:163:178:180 Non-structural protein 8 Non-structural protein 7[68 aa] pdb_complex 84 191 hetero 7btf 100.0 D 1 D R1AB_SARS2 B 1 C R1AB_SARS2 87:88:90-92:94:95:97:98:100:102:103:106:110:111:115-117:119:120:122 Non-structural protein 8 Non-structural protein 7[68 aa] pdb_complex 78 191 hetero 7bv1 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 163:178 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 85 189 hetero 7bv1 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 88:91:94:95:97:98:100:102:103:106:110:116-120 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 78 191 hetero 7bv2 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:179 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 78 192 hetero 7bw4 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 163:178-180:182 Non-structural protein 8 Non-structural protein 7[65 aa] pdb_complex 84 191 hetero 7bw4 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 87:88:91:94:95:98:102:103:110:115-120:122 Non-structural protein 8 Non-structural protein 7[65 aa] pdb_complex 79 192 hetero 7bzf 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 163:179 Non-structural protein 8 Non-structural protein 7[68 aa] pdb_complex 84 191 hetero 7bzf 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 84:87:88:91:92:94:95:98:100:103:106:107:110:111:115:116:118-120 Non-structural protein 8 Non-structural protein 7[68 aa] pdb_complex 76 192 hetero 7c2k 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:179 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 53 191 hetero 7c2k 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83-85:87-89:91:92:94:95:97:98:100:102:103:106:107:110:111:115:116:119:120 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 78 191 hetero 7ctt 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 163:180 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 84 111 hetero 7ctt 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 84:87:88:90:91:94:95:97:98:100:103:106:110 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 6 192 hetero 7cxm 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 7cxm 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:90-92:94:96:100:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 7cxn 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178-181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 7cxn 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:92:94:96:98:100:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 7cyq 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178-181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 7cyq 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:91:92:94:96:98:100:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 78 191 hetero 7d4f 100.0 A 1 B R1AB_SARS2 B 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 84 191 hetero 7d4f 100.0 C 1 G R1AB_SARS2 B 1 C R1AB_SARS2 84:87:90:91:94:95:97:98:100:102:103:106:107:110:115-120:122 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 77 192 hetero 7dcd 100.0 B 1 B R1A_SARS2 A 1 A R1A_SARS2 77:80:84:87:88:90-96:98:100:102:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 77 192 hetero 7dcd 100.0 D 1 D R1A_SARS2 C 1 C R1A_SARS2 80:84:87-89:91-95:98:100:103:106:107:110:111:116:117:119:120:122 Non-structural protein 8 Non-structural protein 7[76 aa] pdb_complex 77 189 hetero 7dcd 100.0 F 1 F R1A_SARS2 E 1 E R1A_SARS2 80:87-92:94:95:98:100:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[76 aa] pdb_complex 77 190 hetero 7dcd 100.0 H 1 H R1A_SARS2 G 1 G R1A_SARS2 77:80:84:87-95:100:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 75 191 hetero 7dfg 100.0 D 1 B R1AB_SARS2 E 1 C R1AB_SARS2 162:163:178-180 Non-structural protein 8 Non-structural protein 7[69 aa] pdb_complex 84 191 hetero 7dfg 100.0 F 1 G R1AB_SARS2 E 1 C R1AB_SARS2 84:87:88:90-92:94-96:98:100:102:103:106:107:110:111:115-120:122 Non-structural protein 8 Non-structural protein 7[69 aa] pdb_complex 78 191 hetero 7dfh 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 84 191 hetero 7dfh 100.0 D 1 G R1AB_SARS2 C 1 C R1AB_SARS2 87:88:90:91:94:95:98:100:102:103:106:107:110:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 78 191 hetero 7doi 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178-181 Non-structural protein 8 Non-structural protein 7[69 aa] pdb_complex 84 191 hetero 7doi 100.0 F 1 G R1AB_SARS2 C 1 C R1AB_SARS2 84:87:88:90-92:94:95:98:100:102:103:106:107:110:111:115-120:122:150 Non-structural protein 8 Non-structural protein 7[69 aa] pdb_complex 37 191 hetero 7dok 100.0 D 1 B R1AB_SARS2 E 1 C R1AB_SARS2 162:163:178:181 Non-structural protein 8 Non-structural protein 7[69 aa] pdb_complex 6 191 hetero 7dok 100.0 F 1 G R1AB_SARS2 E 1 C R1AB_SARS2 83:84:87:88:91:92:94:95:98:100:103:106:107:110:111:115-120:122:150 Non-structural protein 8 Non-structural protein 7[69 aa] pdb_complex 6 192 hetero 7dte 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:179:181 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 7dte 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83-85:87:88:90-92:94:95:97:98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 43 192 hetero 7ed5 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 38 191 hetero 7ed5 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87-89:91:92:94-96:98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 7egq 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 7egq 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 84:87:88:91:92:96:98:100:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 7egq 100.0 J 1 O R1AB_SARS2 K 1 P R1AB_SARS2 163:181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 7egq 100.0 L 1 Q R1AB_SARS2 K 1 P R1AB_SARS2 84:87:91:92:94-96:98:100:102:103:106:107:110:111:118-120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 7eiz 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 163:179-181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 7eiz 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 84:91:92:94:96:98:100:103:106:107:110:111:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 77 192 hetero 7jlt 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:84:85:87-89:91-95:97:98:100:102:103:106:107:111:116:119:120:122 Non-structural protein 8 Non-structural protein 7[79 aa] pdb_complex 77 192 hetero 7jlt 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 79:82:83:86:87:90:94 Non-structural protein 8 Non-structural protein 7[81 aa] pdb_complex 77 193 hetero 7jlt 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 82:83:86:87:90:94 Non-structural protein 8 Non-structural protein 7[79 aa] pdb_complex 77 193 hetero 7jlt 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 80:84:85:87-89:91:92:94-96:98:100:103:106:107:111:116:119:120:122:150 Non-structural protein 8 Non-structural protein 7[81 aa] pdb_complex 6 191 hetero 7krn 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7krn 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:91:92:94-96:98:100:102:103:106:107:110:111:115-120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 191 hetero 7kro 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7kro 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:91:92:94-96:98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 191 hetero 7krp 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7krp 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:91:92:94-96:98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 78 191 hetero 7l1f 100.0 B 1 C R1AB_SARS2 C 1 D R1AB_SARS2 179 Non-structural protein 8 Non-structural protein 7[63 aa] pdb_complex 111 191 hetero 7oyg 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:179 SARS-CoV-2 nsp8 SARS-CoV-2 nsp7[62 aa] pdb_complex 111 191 hetero 7oyg 100.0 G 1 E R1AB_SARS2 H 1 F R1AB_SARS2 162:163:179 SARS-CoV-2 nsp8 SARS-CoV-2 nsp7[62 aa] pdb_complex 77 191 hetero 7ozu 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:179:182 Non-structural protein 8 Non-structural protein 7[62 aa] pdb_complex 77 191 hetero 7ozv 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:182 Non-structural protein 8 Non-structural protein 7[62 aa] pdb_complex 6 191 hetero 7rdx 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7rdx 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:90-92:94-98:100:102:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 191 hetero 7rdy 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 163:178:180 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7rdy 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:91:92:94-98:100:102:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 191 hetero 7rdz 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 7 191 hetero 7rdz 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:91:92:94:95:97:98:100:102:103:106:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 7re0 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7re0 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87-89:91:92:94-96:98:100:102:103:106:107:110:111:115:116:119:120:122:150 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 191 hetero 7re1 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7re1 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87-89:91:92:94-98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 191 hetero 7re2 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7re2 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87-89:91:92:94-98:100:102:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 191 hetero 7re3 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7re3 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 87-89:91-96:98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 191 hetero 7re3 100.0 G 1 H R1AB_SARS2 K 1 I R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 7 191 hetero 7re3 100.0 L 1 J R1AB_SARS2 K 1 I R1AB_SARS2 87-89:91-96:98:100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[75 aa] pdb_complex 6 192 hetero 7uo4 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:180 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 192 hetero 7uo4 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:91:92:94:95:97-100:102:103:106:107:110:111:115-120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 7uo7 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:181 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 7uo7 100.0 F 1 D R1AB_SARS2 C 1 C R1AB_SARS2 87:88:90-92:94-98:100:102:103:106:107:110:111:116-120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 195 hetero 7uo9 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 7uo9 100.0 F 1 D R1AB_SARS2 C 1 C R1AB_SARS2 84:87:88:90-92:94-98:100:102:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 192 hetero 7uob 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 7uob 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:91:92:94:98:100:102:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 193 hetero 7uoe 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178-182 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 7uoe 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:90-92:94:95:97:98:100:102:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 192 hetero 8gw1 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163:181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 8gw1 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 84:87:88:91:92:94:96:98:100:103:106:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 8gwb 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163:178-181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 8gwb 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 83:84:87-92:94-96:98:100:102:103:106:107:110:111:115:116:118-120:122:150 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 195 hetero 8gwe 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163 Non-structural protein 8 Replicase polyprotein 1a[78 aa] pdb_complex 6 192 hetero 8gwe 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 83:84:87-89:91-96:98:100:103:106-108:110:111:115:116:119:120:122 Non-structural protein 8 Replicase polyprotein 1a[78 aa] pdb_complex 6 192 hetero 8gwf 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163 Non-structural protein 8 Non-structural protein 7[78 aa] pdb_complex 6 192 hetero 8gwf 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 83:84:87-89:91-96:98:100:103:106-108:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[78 aa] pdb_complex 6 192 hetero 8gwg 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163 Non-structural protein 8 Non-structural protein 7[78 aa] pdb_complex 6 192 hetero 8gwg 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 83:84:87-89:91-96:98:100:103:106-108:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[78 aa] pdb_complex 6 192 hetero 8gwi 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163 Non-structural protein 8 Non-structural protein 7[78 aa] pdb_complex 6 192 hetero 8gwi 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 83:84:87-89:91-96:98:100:103:106-108:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[78 aa] pdb_complex 6 192 hetero 8gwk 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163:178:181 Non-structural protein 8 Non-structural protein 7[76 aa] pdb_complex 6 191 hetero 8gwk 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 84:87-89:91-94:96-98:100:102:103:106-108:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[76 aa] pdb_complex 6 192 hetero 8gwm 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 8gwm 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 84:87:88:91:92:94:96:98:100:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 8gwn 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163:181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 8gwn 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 87:88:91:92:94:96:98-100:103:106:107:110:111:116:119:120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 8gwo 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 162:163:178 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 191 hetero 8gwo 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 83:87:88:91:92:94:96:98:100:103:106:107:110:111:116:118-120:122:190 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 78 191 hetero 8gy6 100.0 B 1 B R1AB_SARS2 C 1 C R1A_SARS2 163 Non-structural protein 8 Non-structural protein 7[56 aa] pdb_complex 84 132 hetero 8gy6 100.0 D 1 D R1AB_SARS2 C 1 C R1A_SARS2 84:87:90:94:97:98:101-103:122 Non-structural protein 8 Non-structural protein 7[56 aa] pdb_complex 6 191 hetero 8sq9 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 162:163:178:180:181 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 191 hetero 8sq9 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:90-92:94-98:100:102:103:106:107:110:111:116:118-120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 6 192 hetero 8sqj 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 163:178:180:181 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 7 191 hetero 8sqj 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87:88:90-92:94-96:98:100:102:103:106:107:110:111:115:116:118-120:122 Non-structural protein 8 Non-structural protein 7[72 aa] pdb_complex 6 192 hetero 8sqk 100.0 B 1 B R1AB_SARS2 C 1 C R1AB_SARS2 163:178-181 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 7 191 hetero 8sqk 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 83:84:87-89:91:92:94-96:98-100:102:103:106:107:110:111:115:116:119:120:122 Non-structural protein 8 Non-structural protein 7[73 aa] pdb_complex 84 132 hetero 6m71 100.0 C 1 D R1AB_SARS2 A 1 A R1AB_SARS2 90:97 Non-structural protein 8 RNA-directed RNA polymerase[859 aa] pdb_complex 78 191 hetero 6m71 100.0 D 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86:87:90-92:94:95:98:99:103:104:106:107:109:110:112-122:125:127-131:133:141:149:154:164:183 Non-structural protein 8 RNA-directed RNA polymerase[859 aa] pdb_complex 77 191 hetero 6nur 96.5 B 1 B R1A_CVHSA A 1 A R1AB_CVHSA 79:80:83:84:86-88:90-92:94:95:98:99:103:104:106:109-122:124:125:127-131:133:137:141:149:154:183:185 NSP8 NSP12[793 aa] pdb_complex 84 192 hetero 6nur 96.3 D 1 D R1A_CVHSA A 1 A R1AB_CVHSA 90:94 NSP8 NSP12[793 aa] pdb_complex 6 191 hetero 6xez 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:82-84:87:88:94:95:97:100:104:110:113-122:125:127-131:133:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 6xez 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70-72:75:79:83:94 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 78 191 hetero 6xqb 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90:91:94:95:98:99:103:106:107:110:112-121:127-131:133:141:149:162 Non-structural protein 8 RNA-directed RNA polymerase[801 aa] pdb_complex 84 114 hetero 6xqb 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 90 Non-structural protein 8 RNA-directed RNA polymerase[801 aa] pdb_complex 6 191 hetero 6yyt 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 75:76:79:80:82-84:86:87:90-92:94:95:97:98:103:104:106:107:109-122:125:127-131:133:141:149:185 nsp8 nsp12[853 aa] pdb_complex 6 191 hetero 6yyt 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:70-72:75:79:80:90:94 nsp8 nsp12[853 aa] pdb_complex 78 191 hetero 7aap 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86:87:90-92:94:95:97-99:104:106:109-121:123:125:127-131:133:149:154:162:183:185 Non-structural protein 8 Non-structural protein 12[911 aa] pdb_complex 84 111 hetero 7aap 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 90:94 Non-structural protein 8 Non-structural protein 12[911 aa] pdb_complex 77 191 hetero 7b3b 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90-92:94:95:97:100:104:106:107:112-122:125:127-131:133:141:149:154:183:185 Non-structural protein 8 RNA-directed RNA polymerase nsp12[814 aa] pdb_complex 77 191 hetero 7b3c 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90:91:94:95:97:98:103:106:107:109:110:112-123:125:127-131:133:137:141:149:183:185 Non-structural protein 8 RNA-directed RNA polymerase nsp12[814 aa] pdb_complex 77 191 hetero 7b3d 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:82-84:86-88:90:91:94:95:97:98:100:106:112-123:125:127-131:133:141:149:154:162:183:185 SARS-CoV-2 nsp8 SARS-CoV-2 RNA-dependent RNA polymerase nsp12[814 .. pdb_complex 67 192 hetero 7btf 100.0 C 1 B R1AB_SARS2 A 1 A R1AB_SARS2 69-73:79:80:83:84:86:87:90:91:94:95:97-99:103:106:107:109-123:125:127-131:133:141:149:154:162:183 Non-structural protein 8 RNA-directed RNA polymerase[915 aa] pdb_complex 84 191 hetero 7btf 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 94 Non-structural protein 8 RNA-directed RNA polymerase[915 aa] pdb_complex 78 191 hetero 7bv1 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:84:86-88:90:91:94:95:98:103:104:106:107:110:112-122:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[836 aa] pdb_complex 85 189 hetero 7bv1 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 90:94 Non-structural protein 8 RNA-directed RNA polymerase[836 aa] pdb_complex 78 191 hetero 7bv2 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90-92:94:95:98:99:104:106:109:110:112-119:121-123:125:127-131:133:149:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[834 aa] pdb_complex 78 192 hetero 7bw4 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86:87:90:91:94:95:97-99:104:106:107:109:111-121:125:127-131:133:137:141:149:183:185 Non-structural protein 8 RNA-directed RNA polymerase[811 aa] pdb_complex 79 192 hetero 7bzf 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86:87:90-92:94:95:97:98:103:104:106:107:111-122:125:127-131:133:141:149:150:183:185 Non-structural protein 8 RNA-directed RNA polymerase[914 aa] pdb_complex 84 191 hetero 7bzf 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 90:94 Non-structural protein 8 RNA-directed RNA polymerase[914 aa] pdb_complex 76 192 hetero 7c2k 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86:87:90:91:94:95:98:99:103:104:106:109:110:112-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 53 191 hetero 7c2k 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:70-72:75:76:79:80:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 78 191 hetero 7ctt 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90-92:94:95:97-99:106:107:112-123:125:127-131:133:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[826 aa] pdb_complex 84 111 hetero 7ctt 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 90:94 Non-structural protein 8 RNA-directed RNA polymerase[826 aa] pdb_complex 6 192 hetero 7cxm 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86:87:90:91:94:95:97:104:107:111-122:125:127-131:133:149:154:162:183 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7cxm 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:70-72:75:76:79:80:83:90:94:97 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 192 hetero 7cxn 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86:87:91:94:95:99:104:111-120:125:127-131:133:141:149:162:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7cxn 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:71:72:75:79:80:83 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 192 hetero 7cyq 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90-92:94:95:98:104:106:107:110-122:125:127-131:133:137:141:149:154:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7cyq 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:67:68:71:72:75:79:80:83:90:93:94:97 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 78 191 hetero 7d4f 100.0 A 1 B R1AB_SARS2 D 1 A R1AB_SARS2 80:83:84:86:87:90:91:94:95:98:100:103:104:106:107:109:110:112-123:125:127-131:133:137:141:149:154:183 Non-structural protein 8 RNA-directed RNA polymerase[898 aa] pdb_complex 84 191 hetero 7d4f 100.0 C 1 G R1AB_SARS2 D 1 A R1AB_SARS2 90:94:97 Non-structural protein 8 RNA-directed RNA polymerase[898 aa] pdb_complex 75 191 hetero 7dfg 100.0 D 1 B R1AB_SARS2 C 1 A R1AB_SARS2 76:79:80:83:84:86-88:90:91:94:95:97:100:103:104:106:107:109:111-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[908 aa] pdb_complex 84 191 hetero 7dfg 100.0 F 1 G R1AB_SARS2 C 1 A R1AB_SARS2 90:94 Non-structural protein 8 RNA-directed RNA polymerase[908 aa] pdb_complex 78 191 hetero 7dfh 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86:87:90:91:94:95:97:98:100:103:104:106:107:110:112-121:123:125:127-131:133:137:141:149:154:183:185 Non-structural protein 8 RNA-directed RNA polymeras[908 aa] pdb_complex 84 191 hetero 7dfh 100.0 D 1 G R1AB_SARS2 A 1 A R1AB_SARS2 87:94 Non-structural protein 8 RNA-directed RNA polymeras[908 aa] pdb_complex 78 191 hetero 7doi 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90-92:94:95:97:98:103:104:106:109-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[906 aa] pdb_complex 84 191 hetero 7doi 100.0 F 1 G R1AB_SARS2 A 1 A R1AB_SARS2 87:90:94 Non-structural protein 8 RNA-directed RNA polymerase[906 aa] pdb_complex 37 191 hetero 7dok 100.0 D 1 B R1AB_SARS2 C 1 A R1AB_SARS2 76:79:80:83:84:86:87:90-92:94:95:98:103:104:106:107:109-122:125:127-131:133:137:141:149:154:183:185 Non-structural protein 8 RNA-directed RNA polymerase[925 aa] pdb_complex 6 191 hetero 7dok 100.0 F 1 G R1AB_SARS2 C 1 A R1AB_SARS2 60:64:67:68:70-72:75:76:79:80:83:90:94 Non-structural protein 8 RNA-directed RNA polymerase[925 aa] pdb_complex 6 192 hetero 7dte 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86:87:90:91:94:95:97-99:103:104:106:109-123:125:127-131:133:137:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[928 aa] pdb_complex 6 191 hetero 7dte 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 67:68:70-72:75:76:79:80:83:87:94:97 Non-structural protein 8 RNA-directed RNA polymerase[928 aa] pdb_complex 43 192 hetero 7ed5 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:82-84:86-88:90:91:94:95:97:98:103:104:106:107:109-122:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 38 191 hetero 7ed5 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:71:72:75:76:79:80:90:93:94:97 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 192 hetero 7egq 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:84:87:90:91:94:95:104:106:111-121:127-131:133:137:141:149:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7egq 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:71:72:75:76:79:80:90:93 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 192 hetero 7egq 100.0 J 1 O R1AB_SARS2 I 1 N R1AB_SARS2 76:79:80:83:84:87:88:90:94:95:98:99:106:107:111-121:123:125:127-131:137:141:149:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7egq 100.0 L 1 Q R1AB_SARS2 I 1 N R1AB_SARS2 60:64:67:70-72:75:76:79:80:83:93 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 192 hetero 7eiz 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:80:83:84:86:87:91:92:94:95:104:107:109:111-121:125:127-131:133:141:149:183 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7eiz 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 61:64:67:68:71:72:75:76:79:80:94:97 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7krn 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90:91:94:95:97:98:100:104:106:107:112-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7krn 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70-72:75:76:79:80:83:87:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7kro 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90:91:94:95:97:98:104:106:107:110-121:125:127-131:133:137:149:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7kro 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70-72:75:76:83:87:90:94:97 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7krp 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90:91:94:95:98:104:107:109:111-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7krp 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70-72:75:76:79:80:83:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 78 191 hetero 7l1f 100.0 B 1 C R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86:87:90-92:94:95:97-99:103:107:109:111-120:122:125:127-131:149:183 Non-structural protein 8 RNA-directed RNA polymerase[832 aa] pdb_complex 111 191 hetero 7oyg 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 112-123:125:127-131:133:141:149:154:162:183:185 SARS-CoV-2 nsp8 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)[81.. pdb_complex 111 191 hetero 7oyg 100.0 G 1 E R1AB_SARS2 F 1 D R1AB_SARS2 112-123:125:127-131:133:141:149:154:162:183:185 SARS-CoV-2 nsp8 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)[81.. pdb_complex 77 191 hetero 7ozu 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90:91:94:95:97:98:100:104:106:109:112-123:125:127-131:133:141:149:154:183 Non-structural protein 8 Replicase polyprotein 1ab[814 aa] pdb_complex 77 191 hetero 7ozv 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:82-84:86-88:90-92:94:95:97:98:100:104:106:112-123:125:127-133:141:149:154:183 Non-structural protein 8 Replicase polyprotein 1ab[814 aa] pdb_complex 6 191 hetero 7rdx 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 72:76:79:80:83:84:86-88:90:91:94:95:98:104:106:107:109-121:123:125:127-131:133:137:141:149:154:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7rdx 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70-72:75:76:79:80:83:87:90:94:97 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7rdy 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86:87:90:91:94:95:97:98:104:106:107:111-123:125:127-131:133:137:141:149:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7rdy 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70:71:75:76:79:80:83:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7rdz 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 72:76:79:80:84:87:88:90:91:94:95:97:98:104:106:107:109:111-121:123:125:127-131:137:149:154:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7rdz 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70-72:75:76:79:80:83:87:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7re0 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 72:80:83:84:86-88:90-92:94:95:98:104:106:107:109:112-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7re0 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:71:72:75:76:79:80:83:87:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7re1 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90-92:94:95:97:98:104:106:107:109:112-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7re1 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70-72:74-76:79:80:83:87:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7re2 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90:91:94:95:97:98:104:107:109-123:125:127-131:133:137:149:154:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7re2 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:68:70-72:74-76:79:80:83:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7re3 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90:91:94:95:98:104:106:109:112-122:125:127-131:133:141:149:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7re3 100.0 B 1 B R1AB_SARS2 J 1 G R1AB_SARS2 104:108:111 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7re3 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:64:67:71:72:75:79:80:83:90:94:97 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7re3 100.0 G 1 H R1AB_SARS2 A 1 A R1AB_SARS2 104:108:111 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7re3 100.0 G 1 H R1AB_SARS2 J 1 G R1AB_SARS2 80:83:84:86-88:90:91:94:95:98:104:106:107:109:112-123:125:127-131:133:137:149:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 7 191 hetero 7re3 100.0 L 1 J R1AB_SARS2 J 1 G R1AB_SARS2 60:64:67:71:72:75:79:80:83:90:94:97 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 81 192 hetero 7thm 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 83:84:86:87:90:91:94:95:98:103:104:107:112-123:125:127-131:133:137:141:149:183 Non-structural protein 8 RNA-directed RNA polymerase[860 aa] pdb_complex 6 192 hetero 7uo4 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:82-84:86-88:90:91:94:95:97:106:107:109:111-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 192 hetero 7uo4 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:70-72:75:76:79:80:83:87:90:94 Non-structural protein 8 RNA-directed RNA polymerase[927 aa] pdb_complex 6 191 hetero 7uo7 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90:91:94:95:98:104:106:109-123:125:127-131:137:141:149:154:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7uo7 100.0 F 1 D R1AB_SARS2 A 1 A R1AB_SARS2 61:64:67:68:71:72:75:76:79:80:83:87:90:94 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 195 hetero 7uo9 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90:91:94:95:98:103:104:106:109:112-123:125:127-131:133:137:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 7uo9 100.0 F 1 D R1AB_SARS2 A 1 A R1AB_SARS2 67:68:70-72:75:76:79:80:83:90:94 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 192 hetero 7uob 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86-88:90-92:94:95:104:106:111-119:121-123:125:127-131:133:137:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[929 aa] pdb_complex 6 191 hetero 7uob 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:70-72:75:79:80:90:93:94:97 Non-structural protein 8 RNA-directed RNA polymerase[929 aa] pdb_complex 6 193 hetero 7uoe 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90:91:94:95:97:98:103:104:106:107:109-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[929 aa] pdb_complex 6 191 hetero 7uoe 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:70-72:75:76:79:80:83:90:94:97 Non-structural protein 8 RNA-directed RNA polymerase[929 aa] pdb_complex 6 192 hetero 8gw1 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:80:83:84:86-88:90-92:94:95:98:99:104:106:107:111-120:123:125:127-131:133:137:141:149:185 Non-structural protein 8 Replicase polyprotein 1ab[928 aa] pdb_complex 6 191 hetero 8gw1 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 60:61:64:67:71:72:75:76:79:80:90:93 Non-structural protein 8 Replicase polyprotein 1ab[928 aa] pdb_complex 6 192 hetero 8gwb 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90-92:94:95:97:98:103:104:106:107:109-123:125:127-131:133:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 8gwb 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:71:72:75:76:79:80:83:87:90:93:94:97 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 195 hetero 8gwe 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86:87:90:91:94:95:97:103:104:106:109:111-122:125:127-131:133:137:141:149:162:164 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwe 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:71:72:75:76:79:80:87:93:94:97 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwf 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86:87:90:91:94:95:97:103:104:106:109:111-122:125:127-131:133:137:141:149:162:164 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwf 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:71:72:75:76:79:80:87:93:94:97 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwg 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86:87:90:91:94:95:97:103:104:106:109:111-122:125:127-131:133:137:141:149:162:164 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwg 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:71:72:75:76:79:80:87:93:94:97 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwi 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86:87:90:91:94:95:97:103:104:106:109:111-122:125:127-131:133:137:141:149:162:164 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwi 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:71:72:75:76:79:80:87:93:94:97 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwk 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86-88:90:91:94:95:97-99:104:106:112-123:127-131:133:141:149:154:162:183 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 191 hetero 8gwk 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 61:64:67:68:71:72:75:76:79:80:90:93:94 Non-structural protein 8 RNA-directed RNA polymerase[931 aa] pdb_complex 6 192 hetero 8gwm 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:80:83:84:86:87:90-92:94:95:97-99:104:109:111-121:127-131:133:137:141:149:154:162:164 Non-structural protein 8 RNA-directed RNA polymerase[928 aa] pdb_complex 6 191 hetero 8gwm 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:71:72:75:76:79:83:90 Non-structural protein 8 RNA-directed RNA polymerase[928 aa] pdb_complex 6 192 hetero 8gwn 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:92:94:95:97:98:106:111-120:123:125:127-131:133:141:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 8gwn 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 61:64:67:68:71:72:75:76:79:80:83:87:90:97 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 192 hetero 8gwo 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:87:92:94:95:98:104:109:111:113-122:125:127-131:133:137:141:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 8gwo 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 67:68:72:75:76:79:80:83:90:94 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 78 191 hetero 8gy6 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 79:80:83:84:86-88:90-92:94:95:98:103:104:106:107:109:110:112-123:127-131:133:149:162 Non-structural protein 8 RNA-directed RNA polymerase[859 aa] pdb_complex 6 191 hetero 8sq9 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 76:79:80:83:84:86-88:90:91:94:95:97:98:103:104:106:112-123:125:127-131:133:137:141:149:154:162:183:185 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 191 hetero 8sq9 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 67:68:70-72:74-76:79:80:83:90:94 Non-structural protein 8 RNA-directed RNA polymerase[926 aa] pdb_complex 6 192 hetero 8sqj 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86-88:90:91:94:95:97:98:104:106:112-123:125:127-131:133:137:141:149:183 Non-structural protein 8 RNA-directed RNA polymerase[929 aa] pdb_complex 7 191 hetero 8sqj 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:70-72:75:76:79:80:90:94 Non-structural protein 8 RNA-directed RNA polymerase[929 aa] pdb_complex 6 192 hetero 8sqk 100.0 B 1 B R1AB_SARS2 A 1 A R1AB_SARS2 80:83:84:86-88:90:91:94:95:98:104:106:112-123:125:127-131:133:137:141:149:154:162 Non-structural protein 8 RNA-directed RNA polymerase nsp12[929 aa] pdb_complex 7 191 hetero 8sqk 100.0 D 1 D R1AB_SARS2 A 1 A R1AB_SARS2 64:67:68:70-72:75:76:79:80:83:90:94 Non-structural protein 8 RNA-directed RNA polymerase nsp12[929 aa] pdb_complex 6 191 hetero 6xez 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 59:62:63:67:70:71 Non-structural protein 8 Helicase[596 aa] pdb_complex 6 191 hetero 6xez 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 62:63:70:178:179:183 Non-structural protein 8 Helicase[596 aa] pdb_complex 6 192 hetero 7cxm 100.0 B 1 B R1AB_SARS2 H 1 F R1AB_SARS2 58:59:62:63:65:67:70:71:73:74 Non-structural protein 8 Helicase[596 aa] pdb_complex 6 191 hetero 7cxm 100.0 D 1 D R1AB_SARS2 I 1 E R1AB_SARS2 10:133:179 Non-structural protein 8 Helicase[596 aa] pdb_complex 6 192 hetero 7cxn 100.0 B 1 B R1AB_SARS2 H 1 F R1AB_SARS2 58:59:62:65:67:70:71:73:74 Non-structural protein 8 Helicase[596 aa] pdb_complex 6 191 hetero 7cxn 100.0 D 1 D R1AB_SARS2 I 1 E R1AB_SARS2 63:178:179 Non-structural protein 8 Helicase[596 aa] pdb_complex 6 192 hetero 7cyq 100.0 B 1 B R1AB_SARS2 G 1 F R1AB_SARS2 68:71 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 7cyq 100.0 B 1 B R1AB_SARS2 H 1 E R1AB_SARS2 62:63:67:70:71:73:74:77:78 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 191 hetero 7cyq 100.0 D 1 D R1AB_SARS2 G 1 F R1AB_SARS2 58:59:62:63:65:67:70:71:73:74 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 7egq 100.0 B 1 B R1AB_SARS2 E 1 E R1AB_SARS2 68:71:75:78:82 Non-structural protein 8 Helicase[588 aa] pdb_complex 6 192 hetero 7egq 100.0 B 1 B R1AB_SARS2 Q 1 F R1AB_SARS2 55:58:59:62:65:67:69-71:73:77 Non-structural protein 8 Helicase[596 aa] pdb_complex 6 191 hetero 7egq 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 182 Non-structural protein 8 Helicase[588 aa] pdb_complex 6 192 hetero 7egq 100.0 J 1 O R1AB_SARS2 M 1 R R1AB_SARS2 71:75 Non-structural protein 8 Helicase[588 aa] pdb_complex 6 192 hetero 7egq 100.0 J 1 O R1AB_SARS2 R 1 S R1AB_SARS2 58:59:62:65:67:70:71:73 Non-structural protein 8 Helicase[596 aa] pdb_complex 6 192 hetero 7eiz 100.0 B 1 B R1AB_SARS2 J 1 E R1AB_SARS2 55:58:59:62:65:67:70:71:73 Non-structural protein 8 Helicase[587 aa] pdb_complex 6 192 hetero 7eiz 100.0 B 1 B R1AB_SARS2 K 1 F R1AB_SARS2 71 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7eiz 100.0 D 1 D R1AB_SARS2 K 1 F R1AB_SARS2 58:59:62:65-67:70:73 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7krn 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 59:62:63:70:133:134:179:183 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7kro 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 58-60:62:66:67:69-71:73:74:77 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7kro 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 59:112:134:137:178-180:183 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7rdx 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 55:59:62:63:65-67:70:71:73:74:77 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7rdx 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 62:63:66:70:133:134:182:183 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7rdy 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 55:59:62:63:65:67:69-71:73 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7rdy 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 9:10:59:63:70:112:134:137:178-180:182:183 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7rdz 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 55:58:59:62:67:70:71:73:74 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7rdz 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 8 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7re0 100.0 B 1 B R1AB_SARS2 E 1 E R1AB_SARS2 71 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7re0 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 59:63:67:69-71:73:74:77:78 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7re0 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 58:59:62:65:66:69:70:73:77:78 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7re1 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 58:59:63:67:69-71:73:74:77:78 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7re1 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 59:63:133:136:182:183 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7re2 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 59:63:70:77:133:179:182:183 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7re3 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 59:62:67:70:73:78 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7re3 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 59:70:133:134:178:182:183 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 191 hetero 7re3 100.0 G 1 H R1AB_SARS2 N 1 L R1AB_SARS2 58:59:62:63:70:71:73:74 Non-structural protein 8 Helicase[590 aa] pdb_complex 7 191 hetero 7re3 100.0 L 1 J R1AB_SARS2 M 1 K R1AB_SARS2 59:70:133:134:178:182:183 Non-structural protein 8 Helicase[590 aa] pdb_complex 6 192 hetero 8gw1 100.0 B 1 B R1AB_SARS2 G 1 E R1AB_SARS2 71 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gw1 100.0 B 1 B R1AB_SARS2 H 1 F R1AB_SARS2 58:59:62:63:67:69-71:73-75 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 191 hetero 8gw1 100.0 D 1 D R1AB_SARS2 G 1 E R1AB_SARS2 58:59:62:63:67:70:71:73:74 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwb 100.0 B 1 B R1AB_SARS2 E 1 F R1AB_SARS2 64:67:68:71 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwb 100.0 B 1 B R1AB_SARS2 F 1 E R1AB_SARS2 55:59:62:63:66:67:70:71:73:74:77 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 191 hetero 8gwb 100.0 D 1 D R1AB_SARS2 E 1 F R1AB_SARS2 55:59:62:63:66:67:69-71:73:74 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 195 hetero 8gwe 100.0 B 1 B R1AB_SARS2 E 1 E R1AB_SARS2 59:62:66:67:69:70:73:77 Non-structural protein 8 Helicase nsp13[586 aa] pdb_complex 6 195 hetero 8gwe 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 68:71:75 Non-structural protein 8 Helicase nsp13[586 aa] pdb_complex 6 192 hetero 8gwe 100.0 D 1 D R1AB_SARS2 F 1 F R1AB_SARS2 58:62:63:66:67:70:71:73 Non-structural protein 8 Helicase nsp13[586 aa] pdb_complex 6 192 hetero 8gwf 100.0 B 1 B R1AB_SARS2 G 1 F R1AB_SARS2 68:71:75 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwf 100.0 B 1 B R1AB_SARS2 H 1 E R1AB_SARS2 59:62:66:67:69:70:73:77 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwf 100.0 D 1 D R1AB_SARS2 G 1 F R1AB_SARS2 58:62:63:66:67:70:71:73 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwg 100.0 B 1 B R1AB_SARS2 G 1 F R1AB_SARS2 68:71:75 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwg 100.0 B 1 B R1AB_SARS2 H 1 E R1AB_SARS2 59:62:66:67:69:70:73:77 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwg 100.0 D 1 D R1AB_SARS2 G 1 F R1AB_SARS2 58:62:63:66:67:70:71:73 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwi 100.0 B 1 B R1AB_SARS2 G 1 F R1AB_SARS2 68:71:75 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwi 100.0 B 1 B R1AB_SARS2 H 1 E R1AB_SARS2 59:62:66:67:69:70:73:77 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwi 100.0 D 1 D R1AB_SARS2 G 1 F R1AB_SARS2 58:62:63:66:67:70:71:73 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 192 hetero 8gwk 100.0 B 1 B R1AB_SARS2 G 1 E R1AB_SARS2 71:75 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwk 100.0 B 1 B R1AB_SARS2 H 1 F R1AB_SARS2 58:59:62:67:70:71:73 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 191 hetero 8gwk 100.0 D 1 D R1AB_SARS2 G 1 E R1AB_SARS2 59:67:69:70:73:78 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwm 100.0 B 1 B R1AB_SARS2 E 1 E R1AB_SARS2 71 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwm 100.0 B 1 B R1AB_SARS2 F 1 F R1AB_SARS2 59:62:63:67:70:71:73:77 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 191 hetero 8gwm 100.0 D 1 D R1AB_SARS2 E 1 E R1AB_SARS2 62:67:70:73:77 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwn 100.0 B 1 B R1AB_SARS2 G 1 F R1AB_SARS2 68:71 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwn 100.0 B 1 B R1AB_SARS2 H 1 E R1AB_SARS2 59:62:63:65-67:70:71 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 191 hetero 8gwn 100.0 D 1 D R1AB_SARS2 G 1 F R1AB_SARS2 58:59:62:63:65-67:70:71:73 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwo 100.0 B 1 B R1AB_SARS2 G 1 F R1AB_SARS2 68:71 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 192 hetero 8gwo 100.0 B 1 B R1AB_SARS2 H 1 E R1AB_SARS2 59:62:63:67:70:71:73:74 Non-structural protein 8 Helicase[586 aa] pdb_complex 6 191 hetero 8gwo 100.0 D 1 D R1AB_SARS2 G 1 F R1AB_SARS2 58:59:62:63:65-67:69-71:73:74 Non-structural protein 8 Helicase[585 aa] pdb_complex 6 191 hetero 7egq 100.0 D 1 D R1AB_SARS2 P 1 X R1AB_SARS2 12 Non-structural protein 8 Proofreading exoribonuclease[524 aa] pdb_complex 84 189 hetero 7thm 100.0 D 1 D R1AB_SARS2 C 1 C R1AB_SARS2 91:94:95:110:119:120:122 Non-structural protein 8 Non-structural protein 7[37 aa] pdb_complex 9 190 nucleotide 8urb 44.0 B 1 B U6BRU0_9ALPC E 1 I 51:54 nsp8 RNA (33-MER) pdb_complex 11 190 nucleotide 8urb 43.3 D 1 D U6BRU0_9ALPC E 1 I 50:51:54 nsp8 RNA (33-MER) pdb_complex 11 190 nucleotide 8urb 43.3 D 1 D U6BRU0_9ALPC F 1 J 43:65 nsp8 RNA (55-MER) pdb_complex 6 191 nucleotide 6xez 100.0 B 1 B R1AB_SARS2 G 1 P 50:54 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 6xez 100.0 D 1 D R1AB_SARS2 G 1 P 50:54:57 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 7rdx 100.0 B 1 B R1AB_SARS2 G 1 P 50:51:54 Non-structural protein 8 Product RNA pdb_complex 7 191 nucleotide 7rdx 100.0 D 1 D R1AB_SARS2 G 1 P 50:51:54:57 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 7rdy 100.0 B 1 B R1AB_SARS2 G 1 P 50:51 Non-structural protein 8 Product RNA pdb_complex 7 191 nucleotide 7rdy 100.0 D 1 D R1AB_SARS2 G 1 P 36:51:54 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 7rdz 100.0 B 1 B R1AB_SARS2 G 1 P 50:51 Non-structural protein 8 Product RNA pdb_complex 7 191 nucleotide 7rdz 100.0 D 1 D R1AB_SARS2 G 1 P 50:51:54 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 7re0 100.0 B 1 B R1AB_SARS2 G 1 P 50:51:57 Non-structural protein 8 Product RNA pdb_complex 7 191 nucleotide 7re0 100.0 D 1 D R1AB_SARS2 G 1 P 50:54 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 7re1 100.0 B 1 B R1AB_SARS2 G 1 P 50:51:54:57 Non-structural protein 8 Product RNA pdb_complex 7 191 nucleotide 7re1 100.0 D 1 D R1AB_SARS2 G 1 P 50:51:54:57 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 7re2 100.0 B 1 B R1AB_SARS2 F 1 P 50:51 Non-structural protein 8 Product RNA pdb_complex 7 191 nucleotide 7re2 100.0 D 1 D R1AB_SARS2 F 1 P 50:51:54:57 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 7re3 100.0 B 1 B R1AB_SARS2 H 1 P 50:51:54 Non-structural protein 8 Product RNA pdb_complex 7 191 nucleotide 7re3 100.0 D 1 D R1AB_SARS2 H 1 P 50:51:54 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 7re3 100.0 G 1 H R1AB_SARS2 O 1 Q 50:51 Non-structural protein 8 Product RNA pdb_complex 7 191 nucleotide 7re3 100.0 L 1 J R1AB_SARS2 O 1 Q 54 Non-structural protein 8 Product RNA pdb_complex 6 191 nucleotide 6xez 100.0 B 1 B R1AB_SARS2 H 1 T 43:61 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 6xez 100.0 D 1 D R1AB_SARS2 H 1 T 43 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 6yyt 100.0 B 1 B R1AB_SARS2 F 1 Q 36:40:50:51 nsp8 RNA product pdb_complex 6 191 nucleotide 6yyt 100.0 B 1 B R1AB_SARS2 H 1 U 40:43:44:61 nsp8 RNA product pdb_complex 6 191 nucleotide 6yyt 100.0 D 1 D R1AB_SARS2 F 1 Q 50:51:54 nsp8 RNA product pdb_complex 6 191 nucleotide 6yyt 100.0 D 1 D R1AB_SARS2 H 1 U 40:43 nsp8 RNA product pdb_complex 6 191 nucleotide 6yyt 100.0 D 1 D R1AB_SARS2 G 1 T 61:62:65 nsp8 RNA product pdb_complex 53 191 nucleotide 7c2k 100.0 D 1 D R1AB_SARS2 E 1 F 61:80 Non-structural protein 8 RNA (29-MER) pdb_complex 6 192 nucleotide 7cxm 100.0 B 1 B R1AB_SARS2 E 1 I 50:51 Non-structural protein 8 RNA (25-MER) pdb_complex 6 191 nucleotide 7cxm 100.0 D 1 D R1AB_SARS2 E 1 I 50:51:54:57 Non-structural protein 8 RNA (25-MER) pdb_complex 6 192 nucleotide 7cxn 100.0 B 1 B R1AB_SARS2 E 1 I 50:51 Non-structural protein 8 Primer RNA pdb_complex 6 191 nucleotide 7cxn 100.0 D 1 D R1AB_SARS2 E 1 I 51:54:57 Non-structural protein 8 Primer RNA pdb_complex 6 192 nucleotide 7egq 100.0 B 1 B R1AB_SARS2 S 1 I 50:51 Non-structural protein 8 primer RNA pdb_complex 6 191 nucleotide 7egq 100.0 D 1 D R1AB_SARS2 S 1 I 50:51:58 Non-structural protein 8 primer RNA pdb_complex 6 192 nucleotide 7egq 100.0 J 1 O R1AB_SARS2 U 1 L 51 Non-structural protein 8 primer RNA pdb_complex 6 191 nucleotide 7egq 100.0 L 1 Q R1AB_SARS2 U 1 L 50:58 Non-structural protein 8 primer RNA pdb_complex 6 192 nucleotide 7eiz 100.0 B 1 B R1AB_SARS2 G 1 I 50:51 Non-structural protein 8 primer pdb_complex 6 191 nucleotide 7eiz 100.0 D 1 D R1AB_SARS2 G 1 I 50:51:54 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gw1 100.0 B 1 B R1AB_SARS2 E 1 I 50:51:55 Non-structural protein 8 RNA (25-MER) pdb_complex 6 191 nucleotide 8gw1 100.0 D 1 D R1AB_SARS2 E 1 I 50:51:54 Non-structural protein 8 RNA (25-MER) pdb_complex 6 192 nucleotide 8gwb 100.0 B 1 B R1AB_SARS2 I 1 I 50:51:54 Non-structural protein 8 primer pdb_complex 6 191 nucleotide 8gwb 100.0 D 1 D R1AB_SARS2 I 1 I 50:51:54 Non-structural protein 8 primer pdb_complex 6 195 nucleotide 8gwe 100.0 B 1 B R1AB_SARS2 I 1 I 50:57 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwe 100.0 D 1 D R1AB_SARS2 I 1 I 51 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwf 100.0 B 1 B R1AB_SARS2 E 1 I 50:57 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwf 100.0 D 1 D R1AB_SARS2 E 1 I 51 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwg 100.0 B 1 B R1AB_SARS2 E 1 I 50:57 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwg 100.0 D 1 D R1AB_SARS2 E 1 I 51 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwi 100.0 B 1 B R1AB_SARS2 E 1 I 50:57 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwi 100.0 D 1 D R1AB_SARS2 E 1 I 51 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwk 100.0 B 1 B R1AB_SARS2 E 1 I 46:50:51:57 Non-structural protein 8 primer pdb_complex 6 191 nucleotide 8gwk 100.0 D 1 D R1AB_SARS2 E 1 I 51:54:58 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwm 100.0 B 1 B R1AB_SARS2 H 1 I 50:51 Non-structural protein 8 RNA (25-MER) pdb_complex 6 191 nucleotide 8gwm 100.0 D 1 D R1AB_SARS2 H 1 I 50:54 Non-structural protein 8 RNA (25-MER) pdb_complex 6 192 nucleotide 8gwn 100.0 B 1 B R1AB_SARS2 E 1 I 50:51:57 Non-structural protein 8 primer pdb_complex 6 191 nucleotide 8gwn 100.0 D 1 D R1AB_SARS2 E 1 I 51 Non-structural protein 8 primer pdb_complex 6 192 nucleotide 8gwo 100.0 B 1 B R1AB_SARS2 E 1 I 50:54 Non-structural protein 8 RNA (25-MER) pdb_complex 6 191 nucleotide 8gwo 100.0 D 1 D R1AB_SARS2 E 1 I 50:51:54 Non-structural protein 8 RNA (25-MER) pdb_complex 6 192 nucleotide 7cxm 100.0 B 1 B R1AB_SARS2 F 1 J 43 Non-structural protein 8 RNA (26-MER) pdb_complex 6 191 nucleotide 7cxm 100.0 D 1 D R1AB_SARS2 F 1 J 39:43:61 Non-structural protein 8 RNA (26-MER) pdb_complex 6 192 nucleotide 7cxn 100.0 B 1 B R1AB_SARS2 F 1 J 42:43 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7cxn 100.0 D 1 D R1AB_SARS2 F 1 J 43:47:65 Non-structural protein 8 Template RNA pdb_complex 6 192 nucleotide 7cyq 100.0 B 1 B R1AB_SARS2 E 1 I 46:51 Non-structural protein 8 Primer pdb_complex 6 191 nucleotide 7cyq 100.0 D 1 D R1AB_SARS2 E 1 I 50:51:54 Non-structural protein 8 Primer pdb_complex 6 192 nucleotide 7cyq 100.0 B 1 B R1AB_SARS2 F 1 J 43 Non-structural protein 8 Template pdb_complex 6 191 nucleotide 7cyq 100.0 D 1 D R1AB_SARS2 F 1 J 39:43:44:47:58:65 Non-structural protein 8 Template pdb_complex 37 191 nucleotide 7dok 100.0 D 1 B R1AB_SARS2 A 1 P 50 Non-structural protein 8 RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. pdb_complex 6 191 nucleotide 7dok 100.0 F 1 G R1AB_SARS2 A 1 P 50:51:54:57 Non-structural protein 8 RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. pdb_complex 43 192 nucleotide 7ed5 100.0 B 1 B R1AB_SARS2 E 1 I 46:50 Non-structural protein 8 RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. pdb_complex 38 191 nucleotide 7ed5 100.0 D 1 D R1AB_SARS2 E 1 I 50:51:54:57:58 Non-structural protein 8 RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. pdb_complex 6 191 nucleotide 7dok 100.0 F 1 G R1AB_SARS2 B 1 T 40:43:44:61:65 Non-structural protein 8 RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. pdb_complex 6 192 nucleotide 7dte 100.0 B 1 B R1AB_SARS2 E 1 F 39:40:43 Non-structural protein 8 RNA (57-MER) pdb_complex 6 191 nucleotide 7dte 100.0 D 1 D R1AB_SARS2 E 1 F 40:43:46:47:61:65 Non-structural protein 8 RNA (57-MER) pdb_complex 6 192 nucleotide 7dte 100.0 B 1 B R1AB_SARS2 F 1 G 32:33:36:37:50:51 Non-structural protein 8 RNA (33-MER) pdb_complex 6 191 nucleotide 7dte 100.0 D 1 D R1AB_SARS2 F 1 G 36:50:51:54:57 Non-structural protein 8 RNA (33-MER) pdb_complex 43 192 nucleotide 7ed5 100.0 B 1 B R1AB_SARS2 F 1 J 43:46 Non-structural protein 8 RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. pdb_complex 38 191 nucleotide 7ed5 100.0 D 1 D R1AB_SARS2 F 1 J 43:44:47:61:62:65 Non-structural protein 8 RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. pdb_complex 6 192 nucleotide 7egq 100.0 B 1 B R1AB_SARS2 T 1 J 43:46 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7egq 100.0 D 1 D R1AB_SARS2 T 1 J 39:43:44:46:47 Non-structural protein 8 Template RNA pdb_complex 6 192 nucleotide 7egq 100.0 J 1 O R1AB_SARS2 V 1 M 43 Non-structural protein 8 Template RNA pdb_complex 6 192 nucleotide 7eiz 100.0 B 1 B R1AB_SARS2 H 1 J 43 Non-structural protein 8 template pdb_complex 6 191 nucleotide 7eiz 100.0 D 1 D R1AB_SARS2 H 1 J 43:47:65 Non-structural protein 8 template pdb_complex 6 195 nucleotide 8gwe 100.0 B 1 B R1AB_SARS2 J 1 J 43:61 Non-structural protein 8 template pdb_complex 6 192 nucleotide 8gwe 100.0 D 1 D R1AB_SARS2 J 1 J 43:61:65 Non-structural protein 8 template pdb_complex 6 191 nucleotide 7krn 100.0 B 1 B R1AB_SARS2 F 1 P 36:47:50:51:54 Non-structural protein 8 RNA (37-MER) pdb_complex 7 191 nucleotide 7krn 100.0 D 1 D R1AB_SARS2 F 1 P 36:50:51:54:57 Non-structural protein 8 RNA (37-MER) pdb_complex 6 191 nucleotide 7kro 100.0 B 1 B R1AB_SARS2 G 1 P 50 Non-structural protein 8 RNA (37-MER) pdb_complex 7 191 nucleotide 7kro 100.0 D 1 D R1AB_SARS2 G 1 P 36:50:51:54 Non-structural protein 8 RNA (37-MER) pdb_complex 6 191 nucleotide 7krp 100.0 B 1 B R1AB_SARS2 E 1 P 50:51:54 Non-structural protein 8 RNA (37-MER) pdb_complex 7 191 nucleotide 7krp 100.0 D 1 D R1AB_SARS2 E 1 P 36:50:51:54 Non-structural protein 8 RNA (37-MER) pdb_complex 6 191 nucleotide 7krn 100.0 B 1 B R1AB_SARS2 G 1 T 40:43:44:61 Non-structural protein 8 RNA (43-MER) pdb_complex 7 191 nucleotide 7krn 100.0 D 1 D R1AB_SARS2 G 1 T 40:43:65 Non-structural protein 8 RNA (43-MER) pdb_complex 6 191 nucleotide 7kro 100.0 B 1 B R1AB_SARS2 H 1 T 40:43 Non-structural protein 8 RNA (43-MER) pdb_complex 7 191 nucleotide 7kro 100.0 D 1 D R1AB_SARS2 H 1 T 40:43:46:61:65 Non-structural protein 8 RNA (43-MER) pdb_complex 6 191 nucleotide 7krp 100.0 B 1 B R1AB_SARS2 F 1 T 40:43:44 Non-structural protein 8 RNA (36-MER) pdb_complex 7 191 nucleotide 7krp 100.0 D 1 D R1AB_SARS2 F 1 T 40:43:46:61:65 Non-structural protein 8 RNA (36-MER) pdb_complex 6 191 nucleotide 7rdx 100.0 B 1 B R1AB_SARS2 H 1 T 40:43:44:47:61 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 7rdx 100.0 D 1 D R1AB_SARS2 H 1 T 40:43:61:65 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7rdy 100.0 B 1 B R1AB_SARS2 H 1 T 40:43:58 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 7rdy 100.0 D 1 D R1AB_SARS2 H 1 T 40:43:61:65 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7rdz 100.0 B 1 B R1AB_SARS2 H 1 T 40:43:47:61 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 7rdz 100.0 D 1 D R1AB_SARS2 H 1 T 40:43:47:61:65 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7re0 100.0 B 1 B R1AB_SARS2 H 1 T 40:43:47:61 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 7re0 100.0 D 1 D R1AB_SARS2 H 1 T 43:47:61:65 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7re1 100.0 B 1 B R1AB_SARS2 H 1 T 40:43:44:47:61 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 7re1 100.0 D 1 D R1AB_SARS2 H 1 T 40:43:46:47:61:65 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7re2 100.0 B 1 B R1AB_SARS2 G 1 T 40:43:44:47 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 7re2 100.0 D 1 D R1AB_SARS2 G 1 T 40:43:61:65 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7re3 100.0 B 1 B R1AB_SARS2 I 1 T 40:43:47:61 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 7re3 100.0 D 1 D R1AB_SARS2 I 1 T 43:61:62:65 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 7re3 100.0 G 1 H R1AB_SARS2 P 1 U 40:43:47:61 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 7re3 100.0 L 1 J R1AB_SARS2 P 1 U 43:61:62:65 Non-structural protein 8 Template RNA pdb_complex 6 192 nucleotide 7uo4 100.0 B 1 B R1AB_SARS2 E 1 P 36:50:51 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 192 nucleotide 7uo4 100.0 D 1 D R1AB_SARS2 E 1 P 36:50:54 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 192 nucleotide 7uo4 100.0 B 1 B R1AB_SARS2 F 1 T 40:43 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 192 nucleotide 7uo4 100.0 D 1 D R1AB_SARS2 F 1 T 43:58:61:62 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 191 nucleotide 7uo7 100.0 B 1 B R1AB_SARS2 D 1 P 33:36:50 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 191 nucleotide 7uo7 100.0 F 1 D R1AB_SARS2 D 1 P 36:50:51:54 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 191 nucleotide 7uo7 100.0 B 1 B R1AB_SARS2 E 1 T 40:43:58 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 191 nucleotide 7uo7 100.0 F 1 D R1AB_SARS2 E 1 T 40:43:61:65 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 195 nucleotide 7uo9 100.0 B 1 B R1AB_SARS2 D 1 P 50:51 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 191 nucleotide 7uo9 100.0 F 1 D R1AB_SARS2 D 1 P 36:50:51:54:57 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 195 nucleotide 7uo9 100.0 B 1 B R1AB_SARS2 E 1 T 40:43 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 191 nucleotide 7uo9 100.0 F 1 D R1AB_SARS2 E 1 T 40:43:47:61 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 191 nucleotide 8sq9 100.0 B 1 B R1AB_SARS2 G 1 T 43:44 Non-structural protein 8 Template RNA pdb_complex 6 191 nucleotide 8sq9 100.0 D 1 D R1AB_SARS2 G 1 T 40:43:61:65 Non-structural protein 8 Template RNA pdb_complex 6 192 nucleotide 7uob 100.0 B 1 B R1AB_SARS2 E 1 P 50:51 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 191 nucleotide 7uob 100.0 D 1 D R1AB_SARS2 E 1 P 51:54:57 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 193 nucleotide 7uoe 100.0 B 1 B R1AB_SARS2 E 1 P 33:50:51 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 191 nucleotide 7uoe 100.0 D 1 D R1AB_SARS2 E 1 P 36:51:54 Non-structural protein 8 Product RNA (35-MER) pdb_complex 6 192 nucleotide 7uob 100.0 B 1 B R1AB_SARS2 F 1 T 40:43:61 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 191 nucleotide 7uob 100.0 D 1 D R1AB_SARS2 F 1 T 40:43:58:61:65 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 193 nucleotide 7uoe 100.0 B 1 B R1AB_SARS2 F 1 T 40:43:44:47 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 191 nucleotide 7uoe 100.0 D 1 D R1AB_SARS2 F 1 T 40:43:44:46:47:61:65 Non-structural protein 8 Template RNA (55-MER) pdb_complex 6 192 nucleotide 8gw1 100.0 B 1 B R1AB_SARS2 F 1 J 43:46 Non-structural protein 8 Template pdb_complex 6 191 nucleotide 8gw1 100.0 D 1 D R1AB_SARS2 F 1 J 39:43:58:65 Non-structural protein 8 Template pdb_complex 6 192 nucleotide 8gwk 100.0 B 1 B R1AB_SARS2 F 1 J 43 Non-structural protein 8 template pdb_complex 6 191 nucleotide 8gwk 100.0 D 1 D R1AB_SARS2 F 1 J 40:43:65 Non-structural protein 8 template pdb_complex 6 192 nucleotide 8gwm 100.0 B 1 B R1AB_SARS2 I 1 J 43 Non-structural protein 8 RNA (26-MER) pdb_complex 6 191 nucleotide 8gwm 100.0 D 1 D R1AB_SARS2 I 1 J 43 Non-structural protein 8 RNA (26-MER) pdb_complex 6 192 nucleotide 8gwb 100.0 B 1 B R1AB_SARS2 J 1 J 39:40:43:44:58:61 Non-structural protein 8 template pdb_complex 6 191 nucleotide 8gwb 100.0 D 1 D R1AB_SARS2 J 1 J 39:40:43:44:47:61:62 Non-structural protein 8 template pdb_complex 6 192 nucleotide 8gwf 100.0 B 1 B R1AB_SARS2 F 1 J 43:61 Non-structural protein 8 template pdb_complex 6 192 nucleotide 8gwf 100.0 D 1 D R1AB_SARS2 F 1 J 43:61:65 Non-structural protein 8 template pdb_complex 6 192 nucleotide 8gwg 100.0 B 1 B R1AB_SARS2 F 1 J 43:61 Non-structural protein 8 Template pdb_complex 6 192 nucleotide 8gwg 100.0 D 1 D R1AB_SARS2 F 1 J 43:61:65 Non-structural protein 8 Template pdb_complex 6 192 nucleotide 8gwi 100.0 B 1 B R1AB_SARS2 F 1 J 43:61 Non-structural protein 8 RNA (27-MER) pdb_complex 6 192 nucleotide 8gwi 100.0 D 1 D R1AB_SARS2 F 1 J 43:61:65 Non-structural protein 8 RNA (27-MER) pdb_complex 6 192 nucleotide 8gwn 100.0 B 1 B R1AB_SARS2 F 1 J 39:43:61 Non-structural protein 8 template pdb_complex 6 191 nucleotide 8gwn 100.0 D 1 D R1AB_SARS2 F 1 J 40:43:47 Non-structural protein 8 template pdb_complex 6 192 nucleotide 8gwo 100.0 B 1 B R1AB_SARS2 F 1 J 39:43:61 Non-structural protein 8 template pdb_complex 6 191 nucleotide 8gwo 100.0 D 1 D R1AB_SARS2 F 1 J 43:47 Non-structural protein 8 template pdb_complex 6 191 nucleotide 8sq9 100.0 B 1 B R1AB_SARS2 F 1 P 50:51:54 Non-structural protein 8 Primer RNA pdb_complex 6 191 nucleotide 8sq9 100.0 D 1 D R1AB_SARS2 F 1 P 50:51:54 Non-structural protein 8 Primer RNA pdb_complex 6 192 nucleotide 8sqj 100.0 B 1 B R1AB_SARS2 F 1 P 50 Non-structural protein 8 Primer RNA pdb_complex 7 191 nucleotide 8sqj 100.0 D 1 D R1AB_SARS2 F 1 P 50 Non-structural protein 8 Primer RNA pdb_complex 6 192 nucleotide 8sqj 100.0 B 1 B R1AB_SARS2 G 1 T 40:43:47 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 8sqj 100.0 D 1 D R1AB_SARS2 G 1 T 40:43:61:65 Non-structural protein 8 Template RNA pdb_complex 6 192 nucleotide 8sqk 100.0 B 1 B R1AB_SARS2 F 1 P 50 Non-structural protein 8 Primer RNA pdb_complex 6 192 nucleotide 8sqk 100.0 B 1 B R1AB_SARS2 G 1 T 43 Non-structural protein 8 Template RNA pdb_complex 7 191 nucleotide 8sqk 100.0 D 1 D R1AB_SARS2 G 1 T 40:43:61:65 Non-structural protein 8 Template RNA pdb_complex 7 191 compound 7krn 100.0 D 1 D R1AB_SARS2 T 1 E 1N7 66:67:70 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 7 191 compound 7kro 100.0 D 1 D R1AB_SARS2 U 1 E 1N7 66:67:70 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 7 191 compound 7krp 100.0 D 1 D R1AB_SARS2 M 1 D 1N7 66:67:70 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 7 191 compound 7rdx 100.0 D 1 D R1AB_SARS2 U 1 E 1N7 66:67 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 7 191 compound 7rdy 100.0 D 1 D R1AB_SARS2 O 1 A 1N7 66:67 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 7 191 compound 7re1 100.0 D 1 D R1AB_SARS2 U 1 E 1N7 66:67:70 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 7 191 compound 7re2 100.0 D 1 D R1AB_SARS2 T 1 E 1N7 66:67 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 7 191 compound 7re3 100.0 D 1 D R1AB_SARS2 AA 1 E 1N7 66 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 7 191 compound 7re3 100.0 L 1 J R1AB_SARS2 RA 1 K 1N7 66 Non-structural protein 8 CHAPSO[36 atoms] pdb_complex 9 190 homo 8urb 44.0 B 1 B U6BRU0_9ALPC D 1 D U6BRU0_9ALPC 39 nsp8 nsp8[184 aa] pdb_complex 11 190 homo 8urb 43.3 D 1 D U6BRU0_9ALPC B 1 B U6BRU0_9ALPC 37 nsp8 nsp8[184 aa] pdb_complex 38 192 homo 2ahm 97.4 E 1 E R1AB_CVHSA E 2 E R1AB_CVHSA 46:56:59:60:63:66:67:69:70:77:116-119:129:164-166:185 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[155 aa] pdb_complex 38 192 homo 2ahm 97.4 E 2 E R1AB_CVHSA E 1 E R1AB_CVHSA 46:56:59:60:63:66:67:69:70:77:116-119:129:164-166:185 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[155 aa] pdb_complex 38 192 homo 2ahm 97.4 E 1 E R1AB_CVHSA G 1 G R1AB_CVHSA 64:67:68:70:71 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 38 192 homo 2ahm 97.4 E 1 E R1AB_CVHSA G 2 G R1AB_CVHSA 112:117:133:134:137:162:182:183 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 38 192 homo 2ahm 97.4 E 2 E R1AB_CVHSA G 1 G R1AB_CVHSA 112:117:133:134:137:162:182:183 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 38 192 homo 2ahm 97.4 E 2 E R1AB_CVHSA G 2 G R1AB_CVHSA 64:67:68:70:71 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 38 192 homo 2ahm 97.4 E 1 E R1AB_CVHSA H 1 H R1AB_CVHSA 38-40:42:43 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 38 192 homo 2ahm 97.4 E 2 E R1AB_CVHSA H 2 H R1AB_CVHSA 38-40:42:43 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 50 192 homo 2ahm 97.2 F 1 F R1AB_CVHSA F 2 F R1AB_CVHSA 56:59:60:63:66:67:69:70:78:116-119:129:164-166:185 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[143 aa] pdb_complex 50 192 homo 2ahm 97.2 F 2 F R1AB_CVHSA F 1 F R1AB_CVHSA 56:59:60:63:66:67:69:70:78:116-119:129:164-166:185 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[143 aa] pdb_complex 50 192 homo 2ahm 97.2 F 1 F R1AB_CVHSA H 1 H R1AB_CVHSA 64:67:68:71:73:79 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 50 192 homo 2ahm 97.2 F 1 F R1AB_CVHSA H 2 H R1AB_CVHSA 112:117:131:133:134:137:162:182:183 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 50 192 homo 2ahm 97.2 F 2 F R1AB_CVHSA H 1 H R1AB_CVHSA 112:117:131:133:134:137:162:182:183 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 50 192 homo 2ahm 97.2 F 2 F R1AB_CVHSA H 2 H R1AB_CVHSA 64:67:68:71:73:79 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 1 191 homo 2ahm 97.4 G 1 G R1AB_CVHSA E 1 E R1AB_CVHSA 50-52:54:55:57:58 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[155 aa] pdb_complex 1 191 homo 2ahm 97.4 G 1 G R1AB_CVHSA E 2 E R1AB_CVHSA 40:43:44:46:47:50:51 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[155 aa] pdb_complex 1 191 homo 2ahm 97.4 G 2 G R1AB_CVHSA E 1 E R1AB_CVHSA 40:43:44:46:47:50:51 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[155 aa] pdb_complex 1 191 homo 2ahm 97.4 G 2 G R1AB_CVHSA E 2 E R1AB_CVHSA 50-52:54:55:57:58 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[155 aa] pdb_complex 1 191 homo 2ahm 97.4 G 1 G R1AB_CVHSA H 1 H R1AB_CVHSA 5:63:64:67:71:117-119:122 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 1 191 homo 2ahm 97.4 G 2 G R1AB_CVHSA H 2 H R1AB_CVHSA 5:63:64:67:71:117-119:122 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 2 192 homo 2ahm 97.4 H 1 H R1AB_CVHSA E 1 E R1AB_CVHSA 124:125:155:157:189:191:192 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[155 aa] pdb_complex 2 192 homo 2ahm 97.4 H 2 H R1AB_CVHSA E 2 E R1AB_CVHSA 124:125:155:157:189:191:192 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[155 aa] pdb_complex 2 192 homo 2ahm 97.4 H 1 H R1AB_CVHSA F 1 F R1AB_CVHSA 8:51:52:54:55:57:58 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[143 aa] pdb_complex 2 192 homo 2ahm 97.4 H 1 H R1AB_CVHSA F 2 F R1AB_CVHSA 40:43:44:46:47:50:51 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[143 aa] pdb_complex 2 192 homo 2ahm 97.4 H 2 H R1AB_CVHSA F 1 F R1AB_CVHSA 40:43:44:46:47:50:51 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[143 aa] pdb_complex 2 192 homo 2ahm 97.4 H 2 H R1AB_CVHSA F 2 F R1AB_CVHSA 8:51:52:54:55:57:58 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[143 aa] pdb_complex 2 192 homo 2ahm 97.4 H 1 H R1AB_CVHSA G 1 G R1AB_CVHSA 5:63:64:67:71:117-119:122:123:131 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 2 192 homo 2ahm 97.4 H 2 H R1AB_CVHSA G 2 G R1AB_CVHSA 5:63:64:67:71:117-119:122:123:131 Replicase polyprotein 1ab, heavy chain Replicase polyprotein 1ab, heavy chain[191 aa] pdb_complex 38 192 precipitant 2ahm 97.4 E 1 E R1AB_CVHSA I 1 A GOL 118:119 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 1 E R1AB_CVHSA I 2 A GOL 69 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 2 E R1AB_CVHSA I 1 A GOL 69 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 2 E R1AB_CVHSA I 2 A GOL 118:119 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 1 E R1AB_CVHSA J 1 E GOL 121-123 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 2 E R1AB_CVHSA J 2 E GOL 121-123 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 1 E R1AB_CVHSA K 1 E GOL 118:127 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 1 E R1AB_CVHSA K 2 E GOL 69 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 2 E R1AB_CVHSA K 1 E GOL 69 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 38 192 precipitant 2ahm 97.4 E 2 E R1AB_CVHSA K 2 E GOL 118:127 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 50 192 precipitant 2ahm 97.2 F 1 F R1AB_CVHSA L 1 F GOL 69 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 50 192 precipitant 2ahm 97.2 F 1 F R1AB_CVHSA L 2 F GOL 118:119 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 50 192 precipitant 2ahm 97.2 F 2 F R1AB_CVHSA L 1 F GOL 118:119 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 50 192 precipitant 2ahm 97.2 F 2 F R1AB_CVHSA L 2 F GOL 69 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 50 192 precipitant 2ahm 97.2 F 1 F R1AB_CVHSA M 1 F GOL 121-123 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 50 192 precipitant 2ahm 97.2 F 2 F R1AB_CVHSA M 2 F GOL 121-123 Replicase polyprotein 1ab, heavy chain GLYCEROL[6 atoms] pdb_complex 2 192 precipitant 2ahm 97.4 H 1 H R1AB_CVHSA N 1 H SO4 135:139:173:174 Replicase polyprotein 1ab, heavy chain SULFATE ION[5 atoms] pdb_complex 2 192 precipitant 2ahm 97.4 H 2 H R1AB_CVHSA N 2 H SO4 135:139:173:174 Replicase polyprotein 1ab, heavy chain SULFATE ION[5 atoms] pdb_complex 78 198 precipitant 6wqd 100.0 B 1 B R1AB_SARS2 F 1 B EDO 105:108 Non-structural protein 8 1,2-ETHANEDIOL[4 atoms] pdb_complex 78 198 precipitant 6wqd 100.0 B 1 B R1AB_SARS2 G 1 B EDO 150:190 Non-structural protein 8 1,2-ETHANEDIOL[4 atoms] pdb_complex 78 192 precipitant 6xip 100.0 B 1 B R1AB_SARS2 E 1 B EDO 122:150:190 Non-structural protein 8 1,2-ETHANEDIOL[4 atoms] pdb_complex 78 192 precipitant 6xip 100.0 B 1 B R1AB_SARS2 F 1 B EDO 156-159:166:167:169 Non-structural protein 8 1,2-ETHANEDIOL[4 atoms] pdb_complex 78 194 precipitant 6xip 100.0 D 2 D R1AB_SARS2 H 2 D EDO 122:150:190:194 Non-structural protein 8 1,2-ETHANEDIOL[4 atoms] pdb_complex 78 194 precipitant 6xip 100.0 D 2 D R1AB_SARS2 I 2 D EDO 105:108:109:112 Non-structural protein 8 1,2-ETHANEDIOL[4 atoms] pdb_complex 79 194 precipitant 6wtc 100.0 B 1 B R1AB_SARS2 E 1 B ACY 102:150:190:194 Non-structural protein 8 ACETIC ACID[4 atoms] pdb_complex 78 193 precipitant 6wtc 100.0 D 2 D R1AB_SARS2 F 2 C ACY 78:80 Non-structural protein 8 ACETIC ACID[4 atoms]