#WARNING:no index is registered index "YP_009725255.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725255.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. type start end name pdb_id identity asym_id_homo oper_homo auth_asym_id_homo mol_id_homo asym_id_con oper_con auth_asym_id_con mol_id_con sites description_homo description_con #WARNING:no index is registered index "YP_009725255.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725255.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. length 1 38 id 1 38 query title 1 38 seq 1 38 MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT