#WARNING:no index is registered index "YP_009725305.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725305.1.txt". 
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. type start end name pdb_id identity asym_id_homo oper_homo auth_asym_id_homo mol_id_homo asym_id_con oper_con auth_asym_id_con mol_id_con sites description_homo description_con #WARNING:no index is registered index "YP_009725305.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725305.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein. length 1 113 id 1 113 query title 1 113 seq 1 113 NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ disorder 1 2 predicted_by_DISOPRED disorder 8 8 predicted_by_DISOPRED pdb_monomer 1 113 monomer 6w4b 100.0 B B R1AB_SARS2 1-113 pdb_complex 1 113 hetero 7cyq 100.0 I 1 G R1AB_SARS2 A 1 A R1AB_SARS2 1-4:74:95-97:100:103:104:107 Non-structural protein 9 RNA-directed RNA polymerase[926 aa] pdb_complex 1 113 hetero 7egq 100.0 F 1 G R1AB_SARS2 G 1 H R1AB_SARS2 113 Non-structural protein 9 Non-structural protein 10[131 aa] pdb_complex 1 113 hetero 7egq 100.0 F 1 G R1AB_SARS2 H 1 K R1AB_SARS2 111 Non-structural protein 9 Proofreading exoribonuclease[523 aa] pdb_complex 1 113 hetero 7eiz 100.0 E 1 G R1AB_SARS2 I 1 K R1AB_SARS2 111 Non-structural protein 9 Proofreading exoribonuclease[523 aa] pdb_complex 24 111 hetero 8dqu 100.0 C 1 C R1AB_SARS2 A 1 A 52:53:58:62-68:92:93:95:97:98 Non-structural protein 9 Nanobody[127 aa] pdb_complex 1 113 nucleotide 8gwb 100.0 G 1 G R1AB_SARS2 H 1 M 1 Non-structural protein 9 RNA (5'-R(P*AP*U)-3') pdb_complex 1 113 nucleotide 8gwe 100.0 G 1 G R1AB_SARS2 H 1 H 1 Non-structural protein 9 RNA (5'-R(P*AP*UP*UP*A)-3') pdb_complex 1 113 nucleotide 8sqj 100.0 E 1 G R1AB_SARS2 H 1 O 1 Non-structural protein 9 SARS-CoV-2 5' UTR pdb_complex 1 113 nucleotide 8sqk 100.0 E 1 G R1AB_SARS2 H 1 O 1 Non-structural protein 9 SARS-CoV-2 5' UTR pdb_complex 1 113 compound 7cyq 100.0 I 1 G R1AB_SARS2 L 1 A GDP 1 Non-structural protein 9 GUANOSINE-5'-DIPHOSPHATE[28 atoms] pdb_complex 1 113 compound 7kri 100.0 A 1 A R1AB_SARS2 E 1 A X0Y 33:35:40:42:94:98 Non-structural protein 9 1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. pdb_complex 1 113 compound 7n3k 100.0 A 1 A R1AB_SARS2 I 1 A ODN 71:73:90:96:99 Non-structural protein 9 (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. pdb_complex 1 113 compound 7n3k 100.0 A 1 A R1AB_SARS2 J 1 B ODN 1:97 Non-structural protein 9 (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. pdb_complex 1 113 compound 8gw1 100.0 I 1 G R1AB_SARS2 T 1 G U5P 1 Non-structural protein 9 URIDINE-5'-MONOPHOSPHATE[20 atoms] pdb_complex 1 113 compound 8gwk 100.0 I 1 G R1AB_SARS2 T 1 G F86 1 Non-structural protein 9 [(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. pdb_complex 1 113 compound 8gwm 100.0 G 1 G R1AB_SARS2 S 1 G 6GS 1 Non-structural protein 9 2'-deoxy-2'-fluoro-2'-methyluridine 5'-(trihydroge.. pdb_complex 1 107 compound 8sq9 100.0 E 1 G R1AB_SARS2 O 1 A WSB 1 Non-structural protein 9 5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. pdb_complex 1 113 metal 7cyq 100.0 I 1 G R1AB_SARS2 M 1 A MG 1 Non-structural protein 9 MAGNESIUM ION[1 atoms] pdb_complex 1 107 metal 8sq9 100.0 E 1 G R1AB_SARS2 N 1 A MG 1 Non-structural protein 9 MAGNESIUM ION[1 atoms] pdb_complex 5 113 homo 6w4b 100.0 A 1 A R1AB_SARS2 B 1 B R1AB_SARS2 6:7:71-74:96:97:100:101:104:105:107-109:113 Non-structural protein 9 Non-structural protein 9[116 aa] pdb_complex 1 113 homo 6w9q 100.0 A 1 A R1AB_SARS2 A 2 A R1AB_SARS2 2-4:6:72-75:88:96:97:99-101:103-105:107:110:111 3C-like proteinase peptide, Non-structural protein.. 3C-like proteinase peptide, Non-structural protein.. pdb_complex 1 113 homo 7kri 100.0 A 1 A R1AB_SARS2 B 1 B R1AB_SARS2 71 Non-structural protein 9 Non-structural protein 9[127 aa] pdb_complex 1 113 homo 7kri 100.0 A 1 A R1AB_SARS2 C 1 C R1AB_SARS2 63-65:68:92 Non-structural protein 9 Non-structural protein 9[123 aa] pdb_complex 1 113 homo 7kri 100.0 A 1 A R1AB_SARS2 C 2 C R1AB_SARS2 1-3:35:36:39-41:60-63:67:91:95 Non-structural protein 9 Non-structural protein 9[123 aa] pdb_complex 24 111 homo 8dqu 100.0 C 1 C R1AB_SARS2 D 1 F R1AB_SARS2 30-32:34-47:54-56:88:99:103:106:107:110 Non-structural protein 9 Non-structural protein 9[74 aa] pdb_complex 1 113 precipitant 6w9q 100.0 A 1 A R1AB_SARS2 B 1 A PO4 113 3C-like proteinase peptide, Non-structural protein.. PHOSPHATE ION[5 atoms] pdb_complex 2 113 precipitant 6wc1 100.0 A 1 A C 1 A SO4 52:68 SARS-coV-2 Non-structural protein 9 SULFATE ION[5 atoms] pdb_complex 4 113 precipitant 6wxd 100.0 B 1 B R1AB_SARS2 D 1 B SO4 10:11:32 Non-structural protein 9 SULFATE ION[5 atoms] pdb_complex 4 113 precipitant 6wxd 100.0 B 1 B R1AB_SARS2 E 1 B SO4 27-29:45-47:86 Non-structural protein 9 SULFATE ION[5 atoms] pdb_complex 6 113 precipitant 7bwq 100.0 A 1 A G 1 A SO4 95-97 Nsp9 SULFATE ION[5 atoms] pdb_complex 6 113 precipitant 7bwq 100.0 A 1 A H 1 A SO4 27:45-47:86 Nsp9 SULFATE ION[5 atoms] pdb_complex 4 111 precipitant 7bwq 100.0 B 1 B I 1 B SO4 10:32:34:39 Nsp9 SULFATE ION[5 atoms] pdb_complex 6 113 precipitant 7bwq 100.0 F 2 E K 1 F SO4 111:112 Nsp9 SULFATE ION[5 atoms] pdb_complex 1 113 precipitant 7kri 100.0 C 1 C R1AB_SARS2 J 1 C SO4 39 Non-structural protein 9 SULFATE ION[5 atoms] pdb_complex 1 113 precipitant 7n3k 100.0 A 1 A R1AB_SARS2 K 1 B SO4 96 Non-structural protein 9 SULFATE ION[5 atoms] pdb_complex 1 113 precipitant 7kri 100.0 A 1 A R1AB_SARS2 K 2 C MLI 95-97 Non-structural protein 9 MALONATE ION[7 atoms] pdb_complex 1 106 precipitant 7thm 100.0 E 1 G R1AB_SARS2 I 1 A POP 1 Non-structural protein 9 PYROPHOSPHATE 2-[9 atoms]