type start end name pdb_id identity asym_id_homo oper_homo auth_asym_id_homo mol_id_homo asym_id_con oper_con auth_asym_id_con mol_id_con sites description_homo description_con length 1 468 id 1 468 IL6RA_HUMAN title 1 468 RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor; seq 1 468 MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR uniprot 1 19 SIGNAL uniprot 20 468 CHAIN /note="Interleukin-6 receptor subunit alpha" /id="PRO_0000010895" uniprot 20 355 CHAIN /note="Soluble interleukin-6 receptor subunit alpha" /id="PRO_0000450730" uniprot 20 365 TOPO_DOM /note="Extracellular" uniprot 366 386 TRANSMEM /note="Helical" uniprot 387 468 TOPO_DOM /note="Cytoplasmic" uniprot 26 112 DOMAIN /note="Ig-like C2-type" uniprot 113 217 DOMAIN /note="Fibronectin type-III 1" uniprot 218 316 DOMAIN /note="Fibronectin type-III 2" uniprot 303 328 REGION /note="Disordered" uniprot 421 468 REGION /note="Disordered" uniprot 311 328 COMPBIAS /note="Polar residues" disorder 1 18 predicted_by_DISOPRED disorder 313 331 predicted_by_DISOPRED disorder 333 334 predicted_by_DISOPRED disorder 341 354 predicted_by_DISOPRED disorder 356 356 predicted_by_DISOPRED disorder 358 358 predicted_by_DISOPRED disorder 406 413 predicted_by_DISOPRED disorder 420 468 predicted_by_DISOPRED pdb_monomer 20 318 monomer 1n26 100.0 A A IL6A_HUMAN 20-318 pdb_complex 113 317 hetero 5fuc 99.0 D 1 D D6R9R8_HUMAN:IL6RA_HUMAN A 1 A IL6_HUMAN 127:182:185:247-250:273:296-298:300 INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. INTERLEUKIN-6[152 aa] pdb_complex 113 317 hetero 5fuc 99.0 D 1 D D6R9R8_HUMAN:IL6RA_HUMAN F 1 V 237-240:247:248:250:274-276 INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. VHH6[124 aa] pdb_complex 117 316 hetero 5fuc 99.0 C 1 C D6R9R8_HUMAN:IL6RA_HUMAN E 1 E 235:237-240:247:250:274-276 INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. VHH6[110 aa] pdb_complex 117 316 hetero 7dc8 99.5 C 1 C IL6RA_HUMAN A 1 A 247:248:250:272:273 Interleukin-6 receptor subunit alpha Switch Ab Fab light chain[212 aa] pdb_complex 117 316 hetero 7dc8 99.5 C 1 C IL6RA_HUMAN B 1 B 182:183:249:250:252:296-298:300 Interleukin-6 receptor subunit alpha Switch Ab Fab heavy chain[209 aa] pdb_complex 115 315 hetero 1p9m 100.0 C 1 C IL6RA_HUMAN A 1 A IL6RB_HUMAN 232:233:257:261-264:266:271:280:281:283 Interleukin-6 receptor alpha chain Interleukin-6 receptor beta chain[298 aa] pdb_complex 115 315 hetero 1p9m 100.0 C 1 C IL6RA_HUMAN A 2 A IL6RB_HUMAN 151:153:154:156-158:187:207 Interleukin-6 receptor alpha chain Interleukin-6 receptor beta chain[298 aa] pdb_complex 115 315 hetero 1p9m 100.0 C 1 C IL6RA_HUMAN B 1 B IL6_HUMAN 127:181-183:187:209:212:247-250:296-298:300 Interleukin-6 receptor alpha chain Interleukin-6[163 aa] pdb_complex 117 316 hetero 5fuc 99.0 C 1 C D6R9R8_HUMAN:IL6RA_HUMAN B 1 B IL6_HUMAN 127:153-155:182:183:185:187:189:247-250:273:296-298:300 INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. INTERLEUKIN-6[160 aa] pdb_complex 23 318 hetero 8d82 100.0 A 1 C IL6RA_HUMAN B 1 D IL6_HUMAN 127:155:182:183:187:248-250:296-298:300 Soluble interleukin-6 receptor subunit alpha Interleukin-6[169 aa] pdb_complex 115 315 hetero 8qy5 100.0 C 1 C IL6RA_HUMAN B 1 B IL6_HUMAN 127:155:182:183:187:246:248-250:297:298 Interleukin-6 receptor subunit alpha Interleukin-6[157 aa] pdb_complex 23 318 hetero 8d82 100.0 A 1 C IL6RA_HUMAN C 1 A IL6RB_HUMAN 232:233:261:262:264:266:268:271:280:281:283 Soluble interleukin-6 receptor subunit alpha Interleukin-6 receptor subunit beta[589 aa] pdb_complex 23 318 hetero 8d82 100.0 A 1 C IL6RA_HUMAN F 1 E IL6RB_HUMAN 155:157:187:189:205:207 Soluble interleukin-6 receptor subunit alpha Interleukin-6 receptor subunit beta[589 aa] pdb_complex 209 312 hetero 8iow 100.0 A 1 I IL6RA_HUMAN C 1 L 252:253:269:298:299:303 Interleukin-6 receptor subunit alpha Light chain of Sarilumab Fab[212 aa] pdb_complex 209 312 hetero 8iow 100.0 A 1 I IL6RA_HUMAN D 1 H 248-250:252:270-273:296-299 Interleukin-6 receptor subunit alpha Heavy chain of Sarilumab Fab[207 aa] pdb_complex 215 309 hetero 8j6f 100.0 C 1 I IL6RA_HUMAN A 1 H 248-252:270-273:275:296-298:300 Interleukin-6 receptor subunit alpha Heavy chain of Tocilizumab Fab[211 aa] pdb_complex 215 309 hetero 8j6f 100.0 C 1 I IL6RA_HUMAN D 1 B IL6RA_HUMAN 215:217:243-245:249 Interleukin-6 receptor subunit alpha IL6R-D2 peptide[10 aa] pdb_complex 115 315 hetero 8qy5 100.0 C 1 C IL6RA_HUMAN A 1 A IL6RB_MOUSE 232:233:261:262:265:266:268:269:271:280-284 Interleukin-6 receptor subunit alpha Interleukin-6 receptor subunit beta[584 aa] pdb_complex 115 315 hetero 8qy5 100.0 C 1 C IL6RA_HUMAN F 1 D IL6RB_MOUSE 151:153:155:157:158:189:205:207 Interleukin-6 receptor subunit alpha Interleukin-6 receptor subunit beta[584 aa] pdb_complex 117 316 compound 7dc8 99.5 C 1 C IL6RA_HUMAN H 1 B ATP 298 Interleukin-6 receptor subunit alpha ADENOSINE-5'-TRIPHOSPHATE[31 atoms] pdb_complex 20 318 compound 1n26 100.0 A 1 A IL6A_HUMAN D 1 A NAG 220:221:239:240:242 IL-6 Receptor alpha chain 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. pdb_complex 20 318 compound 1n26 100.0 A 1 A IL6A_HUMAN E 1 A NAG 53-55 IL-6 Receptor alpha chain 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. pdb_complex 20 318 compound 1n26 100.0 A 2 A IL6A_HUMAN E 1 A NAG 309-311 IL-6 Receptor alpha chain 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. pdb_complex 117 316 compound 5fuc 99.0 C 1 C D6R9R8_HUMAN:IL6RA_HUMAN G 1 C NAG 221:223:237 INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-.. 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. pdb_complex 23 318 compound 8d82 100.0 A 1 C IL6RA_HUMAN S 1 C NAG 63:93:107 Soluble interleukin-6 receptor subunit alpha 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. pdb_complex 209 312 compound 8iow 100.0 A 1 I IL6RA_HUMAN F 1 I NAG 245:248:249 Interleukin-6 receptor subunit alpha 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. pdb_complex 20 318 compound 1n26 100.0 A 1 A IL6A_HUMAN H 1 A CYS 183-185:209:211 IL-6 Receptor alpha chain CYSTEINE[7 atoms] pdb_complex 20 318 otherpoly 1n26 100.0 A 1 A IL6A_HUMAN B 1 B 128:129:131:163:164:166:177:245:246 IL-6 Receptor alpha chain 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-al.. pdb_complex 20 318 otherpoly 1n26 100.0 A 1 A IL6A_HUMAN C 1 C 63-65:93:107 IL-6 Receptor alpha chain 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. pdb_complex 23 318 otherpoly 8d82 100.0 A 1 C IL6RA_HUMAN G 1 B 245 Soluble interleukin-6 receptor subunit alpha 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. pdb_complex 20 318 homo 1n26 100.0 A 1 A IL6A_HUMAN A 2 A IL6A_HUMAN 59:73-75:77:80-84:90 IL-6 Receptor alpha chain IL-6 Receptor alpha chain[299 aa] pdb_complex 20 318 homo 1n26 100.0 A 2 A IL6A_HUMAN A 1 A IL6A_HUMAN 225-230:233:287:311-313:315-318 IL-6 Receptor alpha chain IL-6 Receptor alpha chain[299 aa] pdb_complex 209 312 homo 8iow 100.0 A 1 I IL6RA_HUMAN B 1 D2 IL6RA_HUMAN 213-215:217:243-245:249 Interleukin-6 receptor subunit alpha Interleukin-6 receptor subunit alpha[14 aa] pdb_complex 20 318 precipitant 1n26 100.0 A 1 A IL6A_HUMAN F 1 A SO4 274-276 IL-6 Receptor alpha chain SULFATE ION[5 atoms] pdb_complex 20 318 precipitant 1n26 100.0 A 1 A IL6A_HUMAN G 1 A SO4 115:116:137 IL-6 Receptor alpha chain SULFATE ION[5 atoms] pdb_complex 117 316 precipitant 7dc8 99.5 C 1 C IL6RA_HUMAN K 1 C SO4 274-276 Interleukin-6 receptor subunit alpha SULFATE ION[5 atoms] pdb_complex 117 316 precipitant 7dc8 99.5 C 1 C IL6RA_HUMAN L 1 C SO4 293:302:303 Interleukin-6 receptor subunit alpha SULFATE ION[5 atoms]