#WARNING:no index is registered index 'b'YP_009725309.1'' in 'http://www.uniprot.org/uniprot/'

[Summary Bars]

[SiteTable]


Full Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4636 527 13 YP_009725309.1()
QUERYSEQ
AENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLI
PLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIG
DELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDS
PCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725309.1()]

527
region name description
1-10 DISORDER predicted by DISOPRED (1-5,8-8,10-10)

MONOMER
527
pdb_id a1 identity[%]2 description
5c8s B 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t B 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
5c8u D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
5c8u B 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
5c8s D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
5c8t D 94.9 R1AB_CVHSA Guanine-N7 methyltransferase
5nfy B 94.7 Q1T6X8_CVHSA Polyprotein 1ab
5nfy C 94.7 Q1T6X8_CVHSA Polyprotein 1ab
5nfy D 94.7 Q1T6X8_CVHSA Polyprotein 1ab
5nfy A 94.7 Q1T6X8_CVHSA Polyprotein 1ab
7mc5 A 99.7 R1AB_SARS2 Proofreading exoribonuclease
7diy B 100.0 R1AB_SARS2 nsp14-ExoN protein
7mc6 A 99.6 R1AB_SARS2 Proofreading exoribonuclease
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5c8s A R1AB_CVHSA Non-structural protein 10[133 aa] B 98.0
/94.9
49
/49
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s C R1AB_CVHSA Non-structural protein 10[133 aa] D 97.9
/94.9
47
/47
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t A R1AB_CVHSA Non-structural protein 10[133 aa] B 98.0
/94.9
49
/49
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t C R1AB_CVHSA Non-structural protein 10[133 aa] D 97.9
/94.9
48
/48
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u A R1AB_CVHSA Non-structural protein 10[133 aa] B 97.9
/94.9
48
/48
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u C R1AB_CVHSA Non-structural protein 10[133 aa] D 97.8
/94.9
45
/45
R1AB_CVHSA Guanine-N7 methyltransferase
5nfy E Q1T6X8_CVHSA Polyprotein 1ab[132 aa] A 98.0
/94.7
50
/50
Q1T6X8_CVHSA Polyprotein 1ab
5nfy F Q1T6X8_CVHSA Polyprotein 1ab[133 aa] B 98.1
/94.7
54
/54
Q1T6X8_CVHSA Polyprotein 1ab
5nfy H Q1T6X8_CVHSA Polyprotein 1ab[133 aa] C 98.1
/94.7
52
/52
Q1T6X8_CVHSA Polyprotein 1ab
5nfy G Q1T6X8_CVHSA Polyprotein 1ab[133 aa] D 98.0
/94.7
49
/49
Q1T6X8_CVHSA Polyprotein 1ab
7diy A R1AB_SARS2 nsp10 protein[131 aa] B 100.0
/100.0
50
/50
R1AB_SARS2 nsp14-ExoN protein
7mc5 B R1AB_SARS2 Non-structural protein 10[130 aa] A 100.0
/99.7
52
/52
R1AB_SARS2 Proofreading exoribonuclease
7mc6 B R1AB_SARS2 Non-structural protein 10[130 aa] A 100.0
/99.6
50
/50
R1AB_SARS2 Proofreading exoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5c8s K SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
B 100.0
/94.9
14
/14
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s S SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
D 100.0
/94.9
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s L G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..
B 100.0
/94.9
16
/16
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s T G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..
D 100.0
/94.9
16
/16
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t K SAM
S-ADENOSYLMETHIONINE[27 atoms]
B 100.0
/94.9
13
/13
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t R SAM
S-ADENOSYLMETHIONINE[27 atoms]
D 100.0
/94.9
15
/15
R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7mc5 V CL
CHLORIDE ION[1 atoms]
A 100.0
/99.7
1
/1
R1AB_SARS2 Proofreading exoribonuclease
5c8s G ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s H ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s I ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s P ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s Q ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t G ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t H ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t I ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t N ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t P ZN
ZINC ION[1 atoms]
D 100.0
/94.9
5
/5
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u G ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u H ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u I ZN
ZINC ION[1 atoms]
B 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u M ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u N ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u O ZN
ZINC ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5nfy I ZN
ZINC ION[1 atoms]
A 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5nfy J ZN
ZINC ION[1 atoms]
A 100.0
/94.7
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
5nfy K ZN
ZINC ION[1 atoms]
A 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5nfy N ZN
ZINC ION[1 atoms]
B 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5nfy O ZN
ZINC ION[1 atoms]
B 100.0
/94.7
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
5nfy P ZN
ZINC ION[1 atoms]
B 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5nfy Q ZN
ZINC ION[1 atoms]
C 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5nfy R ZN
ZINC ION[1 atoms]
C 100.0
/94.7
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
5nfy S ZN
ZINC ION[1 atoms]
C 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5nfy U ZN
ZINC ION[1 atoms]
D 100.0
/94.7
6
/6
Q1T6X8_CVHSA Polyprotein 1ab
5nfy V ZN
ZINC ION[1 atoms]
D 100.0
/94.7
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
5nfy W ZN
ZINC ION[1 atoms]
D 100.0
/94.7
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
7diy E ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 nsp14-ExoN protein
7diy F ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_SARS2 nsp14-ExoN protein
7mc5 C ZN
ZINC ION[1 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 D ZN
ZINC ION[1 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc6 C ZN
ZINC ION[1 atoms]
A 100.0
/99.6
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc6 D ZN
ZINC ION[1 atoms]
A 100.0
/99.6
4
/4
R1AB_SARS2 Proofreading exoribonuclease
5c8s J MG
MAGNESIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s R MG
MAGNESIUM ION[1 atoms]
D 100.0
/94.9
2
/2
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t J MG
MAGNESIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t Q MG
MAGNESIUM ION[1 atoms]
D 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u J MG
MAGNESIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
5c8u P MG
MAGNESIUM ION[1 atoms]
D 100.0
/94.9
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
7diy G MG
MAGNESIUM ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_SARS2 nsp14-ExoN protein
7mc6 M MG
MAGNESIUM ION[1 atoms]
A 100.0
/99.6
3
/3
R1AB_SARS2 Proofreading exoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
527 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7mc5 P TLA
L(+)-TARTARIC ACID[10 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 Q TLA
L(+)-TARTARIC ACID[10 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Proofreading exoribonuclease
7mc5 AA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
1
/1
R1AB_SARS2 Proofreading exoribonuclease
7mc5 DA EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Proofreading exoribonuclease
7mc5 E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
2
/2
R1AB_SARS2 Proofreading exoribonuclease
7mc5 F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Proofreading exoribonuclease
7mc5 G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Proofreading exoribonuclease
7mc5 J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 K EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Proofreading exoribonuclease
7mc5 N EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 O EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
5
/5
R1AB_SARS2 Proofreading exoribonuclease
7mc5 R EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
5
/5
R1AB_SARS2 Proofreading exoribonuclease
7mc5 S EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
6
/6
R1AB_SARS2 Proofreading exoribonuclease
7mc5 T EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
5
/5
R1AB_SARS2 Proofreading exoribonuclease
7mc5 U EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc5 W EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.7
3
/3
R1AB_SARS2 Proofreading exoribonuclease
7mc6 E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
4
/4
R1AB_SARS2 Proofreading exoribonuclease
7mc6 F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
3
/3
R1AB_SARS2 Proofreading exoribonuclease
7mc6 G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
5
/5
R1AB_SARS2 Proofreading exoribonuclease
7mc6 H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
3
/3
R1AB_SARS2 Proofreading exoribonuclease
7mc6 I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
6
/6
R1AB_SARS2 Proofreading exoribonuclease
7mc6 J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
6
/6
R1AB_SARS2 Proofreading exoribonuclease
7mc6 K EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
3
/3
R1AB_SARS2 Proofreading exoribonuclease
7mc6 P EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
1
/1
R1AB_SARS2 Proofreading exoribonuclease
5nfy L PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/94.7
2
/2
Q1T6X8_CVHSA Polyprotein 1ab
5nfy T PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
C 100.0
/94.7
1
/1
Q1T6X8_CVHSA Polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.