#WARNING:no index is registered index "YP_009725307.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725307.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
19566 932 68 YP_009725307.1()
QUERYSEQ 
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYN
CCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN
CLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAI
SDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHN
MLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLR
KHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML
DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725307.1()]

932
region name description
1-932 DISORDER predicted by DISOPRED

MONOMER
932
pdb_id a1 identity[%]2 description
8gwk A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gwf A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gwg A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gwi A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gwe A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8sqk A 100.0 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7uob A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8sqj A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7uoe A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gwm A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7dte A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 A 99.9 R1AB_SARS2 Replicase polyprotein 1ab
7rdy A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7rdx A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7krn A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7krp A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7kro A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7rdz A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7re3 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7re2 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7re1 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7re0 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7re3 J 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7c2k A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
6xez A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gwn A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gwb A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7egq I 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7eiz A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7egq A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gwo A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7cyq A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7cxn A 99.9 R1AB_SARS2 RNA-directed RNA polymerase
7cxm A 99.9 R1AB_SARS2 RNA-directed RNA polymerase
7dok C 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7btf A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7bzf A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7aap A 100.0 R1AB_SARS2 Non-structural protein 12
7dfg C 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7dfh A 100.0 R1AB_SARS2 RNA-directed RNA polymeras
7doi A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7d4f D 100.0 R1AB_SARS2 RNA-directed RNA polymerase
6m71 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
8gy6 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7thm A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
6yyt A 100.0 R1AB_SARS2 nsp12
7bv1 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7bv2 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7l1f A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7ctt A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
7oyg A 100.0 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7b3d A 100.0 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7b3b A 100.0 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7ozv A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7ozu A 100.0 R1AB_SARS2 Replicase polyprotein 1ab
7b3c A 100.0 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7oyg F 100.0 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7bw4 A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
6xqb A 100.0 R1AB_SARS2 RNA-directed RNA polymerase
6nur A 97.0 R1AB_CVHSA NSP12
6nus A 96.6 R1AB_CVHSA NSP12
8urb A 60.7 U6BRU0_9ALPC nsp12
8g6r A 60.9 A0A0U2C263_9ALPC nsp12 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6m71 B R1AB_SARS2 Non-structural protein 7[70 aa] A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
6nur C R1AB_CVHSA NSP7[70 aa] A 100.0
/97.0		 14
/14		 R1AB_CVHSA NSP12
6xez C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
6xqb C R1AB_SARS2 Non-structural protein 7[62 aa] A 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
6yyt C R1AB_SARS2 nsp7[73 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 nsp12
7aap C R1AB_SARS2 Non-structural protein 7[67 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 Non-structural protein 12
7b3b C R1AB_SARS2 Non-structural protein 7[62 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c C R1AB_SARS2 Non-structural protein 7[62 aa] A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3d C R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7btf B R1AB_SARS2 Non-structural protein 7[68 aa] A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
7bv1 C R1AB_SARS2 Non-structural protein 7[63 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
7bv2 C R1AB_SARS2 Non-structural protein 7[63 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
7bw4 C R1AB_SARS2 Non-structural protein 7[65 aa] A 100.0
/100.0		 10
/10		 R1AB_SARS2 RNA-directed RNA polymerase
7bzf C R1AB_SARS2 Non-structural protein 7[68 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7c2k C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt C R1AB_SARS2 Non-structural protein 7[63 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7cxm C R1AB_SARS2 Non-structural protein 7[72 aa] A 100.0
/99.9		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn C R1AB_SARS2 Non-structural protein 7[72 aa] A 100.0
/99.9		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq C R1AB_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7d4f B R1AB_SARS2 Non-structural protein 7[63 aa] D 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg E R1AB_SARS2 Non-structural protein 7[69 aa] C 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7dfh C R1AB_SARS2 Non-structural protein 7[63 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymeras
7doi C R1AB_SARS2 Non-structural protein 7[69 aa] A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
7dok E R1AB_SARS2 Non-structural protein 7[69 aa] C 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7dte C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 C R1AB_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7egq C R1AB_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
7egq K R1AB_SARS2 Non-structural protein 7[72 aa] I 100.0
/100.0		 8
/8		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz C R1A_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
7krn C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7kro C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7krp C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7l1f C R1AB_SARS2 Non-structural protein 7[63 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7oyg C R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7oyg H R1AB_SARS2 SARS-CoV-2 nsp7[62 aa] F 100.0
/100.0		 15
/15		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7ozu C R1AB_SARS2 Non-structural protein 7[62 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 Replicase polyprotein 1ab
7ozv C R1AB_SARS2 Non-structural protein 7[62 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 Replicase polyprotein 1ab
7rdx C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 C R1AB_SARS2 Non-structural protein 7[75 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 K R1AB_SARS2 Non-structural protein 7[75 aa] J 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7uob C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 C R1A_SARS2 Non-structural protein 7[72 aa] A 100.0
/99.9		 15
/15		 R1AB_SARS2 Replicase polyprotein 1ab
8gwb C R1A_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe C R1A_SARS2 Replicase polyprotein 1a[78 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf C R1A_SARS2 Non-structural protein 7[78 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg C R1A_SARS2 Non-structural protein 7[78 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi C R1A_SARS2 Non-structural protein 7[78 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk C R1A_SARS2 Non-structural protein 7[76 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm C R1A_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn C R1A_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo C R1A_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gy6 C R1A_SARS2 Non-structural protein 7[56 aa] A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj C R1AB_SARS2 Non-structural protein 7[72 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8sqk C R1AB_SARS2 Non-structural protein 7[73 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
6m71 C R1AB_SARS2 Non-structural protein 8[43 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
6m71 D R1AB_SARS2 Non-structural protein 8[113 aa] A 100.0
/100.0		 46
/46		 R1AB_SARS2 RNA-directed RNA polymerase
6nur B R1A_CVHSA NSP8[115 aa] A 100.0
/97.0		 49
/49		 R1AB_CVHSA NSP12
6nur D R1A_CVHSA NSP8[109 aa] A 100.0
/97.0		 2
/2		 R1AB_CVHSA NSP12
6nus B R1A_CVHSA NSP8[112 aa] A 100.0
/96.6		 44
/44		 R1AB_CVHSA NSP12
6xez B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 34
/34		 R1AB_SARS2 RNA-directed RNA polymerase
6xez D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
6xqb B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 40
/40		 R1AB_SARS2 RNA-directed RNA polymerase
6yyt B R1AB_SARS2 nsp8[186 aa] A 100.0
/100.0		 47
/47		 R1AB_SARS2 nsp12
6yyt D R1AB_SARS2 nsp8[186 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 nsp12
7aap B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 48
/48		 R1AB_SARS2 Non-structural protein 12
7b3b B R1AB_SARS2 Non-structural protein 8[115 aa] A 100.0
/100.0		 48
/48		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c B R1AB_SARS2 Non-structural protein 8[115 aa] A 100.0
/100.0		 44
/44		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3d B R1AB_SARS2 SARS-CoV-2 nsp8[115 aa] A 100.0
/100.0		 43
/43		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7btf C R1AB_SARS2 Non-structural protein 8[126 aa] A 100.0
/100.0		 51
/51		 R1AB_SARS2 RNA-directed RNA polymerase
7btf D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7bv1 B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 42
/42		 R1AB_SARS2 RNA-directed RNA polymerase
7bv2 B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 46
/46		 R1AB_SARS2 RNA-directed RNA polymerase
7bw4 B R1AB_SARS2 Non-structural protein 8[115 aa] A 100.0
/100.0		 42
/42		 R1AB_SARS2 RNA-directed RNA polymerase
7bzf B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 51
/51		 R1AB_SARS2 RNA-directed RNA polymerase
7bzf D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7c2k B R1AB_SARS2 Non-structural protein 8[117 aa] A 100.0
/100.0		 48
/48		 R1AB_SARS2 RNA-directed RNA polymerase
7c2k D R1AB_SARS2 Non-structural protein 8[139 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 47
/47		 R1AB_SARS2 RNA-directed RNA polymerase
7cxm B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/99.9		 37
/37		 R1AB_SARS2 RNA-directed RNA polymerase
7cxm D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/99.9		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/99.9		 35
/35		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/99.9		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 42
/42		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7d4f A R1AB_SARS2 Non-structural protein 8[114 aa] D 100.0
/100.0		 48
/48		 R1AB_SARS2 RNA-directed RNA polymerase
7d4f C R1AB_SARS2 Non-structural protein 8[106 aa] D 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg D R1AB_SARS2 Non-structural protein 8[117 aa] C 100.0
/100.0		 47
/47		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg F R1AB_SARS2 Non-structural protein 8[106 aa] C 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7dfh B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 48
/48		 R1AB_SARS2 RNA-directed RNA polymeras
7dfh D R1AB_SARS2 Non-structural protein 8[106 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymeras
7doi B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 49
/49		 R1AB_SARS2 RNA-directed RNA polymerase
7doi F R1AB_SARS2 Non-structural protein 8[106 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7dok D R1AB_SARS2 Non-structural protein 8[155 aa] C 100.0
/100.0		 49
/49		 R1AB_SARS2 RNA-directed RNA polymerase
7dok F R1AB_SARS2 Non-structural protein 8[174 aa] C 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7dte B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 51
/51		 R1AB_SARS2 RNA-directed RNA polymerase
7dte D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 B R1AB_SARS2 Non-structural protein 8[150 aa] A 100.0
/100.0		 52
/52		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 D R1AB_SARS2 Non-structural protein 8[154 aa] A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7egq B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 38
/38		 R1AB_SARS2 RNA-directed RNA polymerase
7egq D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7egq J R1AB_SARS2 Non-structural protein 8[187 aa] I 100.0
/100.0		 37
/37		 R1AB_SARS2 RNA-directed RNA polymerase
7egq L R1AB_SARS2 Non-structural protein 8[186 aa] I 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 38
/38		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7krn B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 48
/48		 R1AB_SARS2 RNA-directed RNA polymerase
7krn D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7kro B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 46
/46		 R1AB_SARS2 RNA-directed RNA polymerase
7kro D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7krp B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 53
/53		 R1AB_SARS2 RNA-directed RNA polymerase
7krp D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7l1f B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/100.0		 40
/40		 R1AB_SARS2 RNA-directed RNA polymerase
7ozu B R1AB_SARS2 Non-structural protein 8[115 aa] A 100.0
/100.0		 45
/45		 R1AB_SARS2 Replicase polyprotein 1ab
7ozv B R1AB_SARS2 Non-structural protein 8[115 aa] A 100.0
/100.0		 50
/50		 R1AB_SARS2 Replicase polyprotein 1ab
7rdx B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 48
/48		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 47
/47		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 50
/50		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 47
/47		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 10
/10		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 51
/51		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 52
/52		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 46
/46		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 G R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 B R1AB_SARS2 Non-structural protein 8[186 aa] J 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 G R1AB_SARS2 Non-structural protein 8[186 aa] J 100.0
/100.0		 47
/47		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 L R1AB_SARS2 Non-structural protein 8[185 aa] J 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7thm B R1AB_SARS2 Non-structural protein 8[108 aa] A 100.0
/100.0		 41
/41		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 50
/50		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 D R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 45
/45		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 F R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 B R1AB_SARS2 Non-structural protein 8[190 aa] A 100.0
/100.0		 52
/52		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 F R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7uob B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 38
/38		 R1AB_SARS2 RNA-directed RNA polymerase
7uob D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe B R1AB_SARS2 Non-structural protein 8[188 aa] A 100.0
/100.0		 50
/50		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/99.9		 40
/40		 R1AB_SARS2 Replicase polyprotein 1ab
8gw1 D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/99.9		 12
/12		 R1AB_SARS2 Replicase polyprotein 1ab
8gwb B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 53
/53		 R1AB_SARS2 RNA-directed RNA polymerase
8gwb D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe B R1AB_SARS2 Non-structural protein 8[190 aa] A 100.0
/100.0		 38
/38		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe D R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 38
/38		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf D R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 38
/38		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg D R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 38
/38		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi D R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 38
/38		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 41
/41		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 34
/34		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 37
/37		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 8
/8		 R1AB_SARS2 RNA-directed RNA polymerase
8gy6 B R1AB_SARS2 Non-structural protein 8[113 aa] A 100.0
/100.0		 46
/46		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 B R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 47
/47		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 40
/40		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8sqk B R1AB_SARS2 Non-structural protein 8[187 aa] A 100.0
/100.0		 42
/42		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
8sqk D R1AB_SARS2 Non-structural protein 8[185 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
6xez E R1AB_SARS2 Helicase[596 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7cxm I R1AB_SARS2 Helicase[596 aa] A 100.0
/99.9		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn H R1AB_SARS2 Helicase[596 aa] A 100.0
/99.9		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn I R1AB_SARS2 Helicase[596 aa] A 100.0
/99.9		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq G R1AB_SARS2 Helicase[585 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7egq E R1AB_SARS2 Helicase[588 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7egq M R1AB_SARS2 Helicase[588 aa] I 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz K R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7krn E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7kro E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 E R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 N R1AB_SARS2 Helicase[590 aa] A 100.0
/100.0		 10
/10		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 F R1AB_SARS2 Helicase[590 aa] J 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 M R1AB_SARS2 Helicase[590 aa] J 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 G R1AB_SARS2 Helicase[585 aa] A 100.0
/99.9		 3
/3		 R1AB_SARS2 Replicase polyprotein 1ab
8gwb E R1AB_SARS2 Helicase[585 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe F R1AB_SARS2 Helicase nsp13[586 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf G R1AB_SARS2 Helicase[586 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg G R1AB_SARS2 Helicase[586 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi G R1AB_SARS2 Helicase[586 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk G R1AB_SARS2 Helicase[585 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm E R1AB_SARS2 Helicase[585 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn G R1AB_SARS2 Helicase[585 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo G R1AB_SARS2 Helicase[585 aa] A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
6xqb D R1AB_SARS2 Non-structural protein 8[31 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7aap D R1AB_SARS2 Non-structural protein 8[28 aa] A 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 12
7ctt D R1AB_SARS2 Non-structural protein 8[28 aa] A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7bv1 D R1AB_SARS2 Non-structural protein 8[99 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
7egq F R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 21
/21		 R1AB_SARS2 RNA-directed RNA polymerase
7egq N R1AB_SARS2 Non-structural protein 9[113 aa] I 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz E R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/99.9		 17
/17		 R1AB_SARS2 Replicase polyprotein 1ab
8gwb G R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe G R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 22
/22		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm G R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo I R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 22
/22		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj E R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 22
/22		 R1AB_SARS2 RNA-directed RNA polymerase
8sqk E R1AB_SARS2 Non-structural protein 9[113 aa] A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7egq H R1AB_SARS2 Proofreading exoribonuclease[523 aa] A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7egq P R1AB_SARS2 Proofreading exoribonuclease[524 aa] A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7egq H R1AB_SARS2 Proofreading exoribonuclease[523 aa] I 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7egq P R1AB_SARS2 Proofreading exoribonuclease[524 aa] I 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz I R1AB_SARS2 Proofreading exoribonuclease[523 aa] A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7oyg B R1AB_SARS2 SARS-CoV-2 nsp8[81 aa] A 100.0
/100.0		 28
/28		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7oyg G R1AB_SARS2 SARS-CoV-2 nsp8[81 aa] F 100.0
/100.0		 28
/28		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7thm C R1AB_SARS2 Non-structural protein 7[37 aa] A 100.0
/100.0		 7
/7		 R1AB_SARS2 RNA-directed RNA polymerase
7thm E R1AB_SARS2 Non-structural protein 9[74 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 E R1AB_SARS2 Non-structural protein 9[98 aa] A 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
8g6r B A0A1Z2R8Q6_9ALPC nsp8[114 aa] A 53.5
/60.9		 43
/44		 A0A0U2C263_9ALPC nsp12
8g6r C A0A0M4AW09_9ALPC nsp7[62 aa] A 81.2
/60.9		 16
/16		 A0A0U2C263_9ALPC nsp12
8urb C U6BRU0_9ALPC nsp7[70 aa] A 86.7
/60.7		 15
/15		 U6BRU0_9ALPC nsp12
8urb B U6BRU0_9ALPC nsp8[184 aa] A 54.3
/60.7		 46
/47		 U6BRU0_9ALPC nsp12
8urb D U6BRU0_9ALPC nsp8[184 aa] A 66.7
/60.7		 12
/12		 U6BRU0_9ALPC nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez G Product RNA A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx G Product RNA A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy G Product RNA A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz G Product RNA A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 G Product RNA A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 G Product RNA A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 F Product RNA A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 H Product RNA A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 O Product RNA J 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
6xez H Template RNA A 100.0
/100.0		 21
/21		 R1AB_SARS2 RNA-directed RNA polymerase
6xqb E RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
6xqb F RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
6yyt E RNA product A 100.0
/100.0		 14
/14		 R1AB_SARS2 nsp12
6yyt G RNA product A 100.0
/100.0		 26
/26		 R1AB_SARS2 nsp12
7aap E RNA (5'-R(P*UP*UP*AP*AP*GP*UP*UP*AP*U)-3') A 100.0
/100.0		 16
/16		 R1AB_SARS2 Non-structural protein 12
7aap F RNA (5'-R(P*UP*UP*CP*AP*UP*AP*AP*CP*UP*UP*AP*A)-3'.. A 100.0
/100.0		 23
/23		 R1AB_SARS2 Non-structural protein 12
7b3b D DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*G)-D(P*(RMP))-R(.. A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3b E RNA (5'-R(P*UP*GP*CP*AP*UP*CP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0		 28
/28		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c D DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*A)-D(P*(RMP))-R(.. A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c E RNA (5'-R(P*UP*CP*AP*CP*UP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0		 26
/26		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3d D RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') A 100.0
/100.0		 14
/14		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7oyg D RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') A 100.0
/100.0		 14
/14		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7oyg I RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') F 100.0
/100.0		 14
/14		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7b3d E RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0		 29
/29		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7oyg E RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/100.0		 29
/29		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7oyg J RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. F 100.0
/100.0		 29
/29		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7bv2 D Primer A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7bv2 E Templete A 100.0
/100.0		 26
/26		 R1AB_SARS2 RNA-directed RNA polymerase
7bzf E RNA (31-MER) A 100.0
/100.0		 25
/25		 R1AB_SARS2 RNA-directed RNA polymerase
7bzf F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7c2k E RNA (29-MER) A 100.0
/100.0		 24
/24		 R1AB_SARS2 RNA-directed RNA polymerase
7c2k F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt E Primer-RNA (5'-R(P*UP*UP*CP*UP*CP*CP*UP*AP*AP*GP*A.. A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt F Template-RNA (5'-R(P*AP*CP*UP*AP*GP*CP*UP*UP*CP*UP.. A 100.0
/100.0		 25
/25		 R1AB_SARS2 RNA-directed RNA polymerase
7cxm E RNA (25-MER) A 100.0
/99.9		 10
/10		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn E Primer RNA A 100.0
/99.9		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
7egq S primer RNA A 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
7egq U primer RNA I 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz G primer A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 E RNA (25-MER) A 100.0
/99.9		 16
/16		 R1AB_SARS2 Replicase polyprotein 1ab
8gwb I primer A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe I primer A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf E primer A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg E primer A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi E primer A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk E primer A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm H RNA (25-MER) A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn E primer A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo E RNA (25-MER) A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq E Primer A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq F Template A 100.0
/100.0		 30
/30		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg A RNA (5'-R(P*AP*GP*AP*UP*UP*AP*AP*GP*UP*UP*AP*U)-3'.. C 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
7doi D RNA (5'-R(P*AP*GP*AP*UP*UP*AP*AP*GP*UP*UP*AP*U)-3'.. A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg B RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. C 100.0
/100.0		 30
/30		 R1AB_SARS2 RNA-directed RNA polymerase
7dfh E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*G*(LIG))-3') A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymeras
7dfh F RNA (5'-R(P*CP*CP*CP*CP*CP*AP*CP*AP*UP*AP*GP*C)-3'.. A 100.0
/100.0		 24
/24		 R1AB_SARS2 RNA-directed RNA polymeras
7doi E RNA (5'-R(P*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP*UP.. A 100.0
/100.0		 28
/28		 R1AB_SARS2 RNA-directed RNA polymerase
7dok A RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. C 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7dok B RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. C 100.0
/100.0		 26
/26		 R1AB_SARS2 RNA-directed RNA polymerase
7dte E RNA (57-MER) A 100.0
/100.0		 27
/27		 R1AB_SARS2 RNA-directed RNA polymerase
7dte F RNA (33-MER) A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 F RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. A 100.0
/100.0		 28
/28		 R1AB_SARS2 RNA-directed RNA polymerase
7egq T Template RNA A 100.0
/100.0		 27
/27		 R1AB_SARS2 RNA-directed RNA polymerase
7egq V Template RNA I 100.0
/100.0		 23
/23		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz H template A 100.0
/100.0		 21
/21		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe J template A 100.0
/100.0		 22
/22		 R1AB_SARS2 RNA-directed RNA polymerase
7krn F RNA (37-MER) A 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
7kro G RNA (37-MER) A 100.0
/100.0		 21
/21		 R1AB_SARS2 RNA-directed RNA polymerase
7krp E RNA (37-MER) A 100.0
/100.0		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
7krn G RNA (43-MER) A 100.0
/100.0		 27
/27		 R1AB_SARS2 RNA-directed RNA polymerase
7kro H RNA (43-MER) A 100.0
/100.0		 27
/27		 R1AB_SARS2 RNA-directed RNA polymerase
7krp F RNA (36-MER) A 100.0
/100.0		 28
/28		 R1AB_SARS2 RNA-directed RNA polymerase
7l1f D RNA (5'-R(P*CP*UP*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*U*.. A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7l1f E RNA (5'-R(P*AP*UP*UP*UP*UP*AP*AP*UP*AP*GP*CP*UP*UP.. A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
7ozu D Product RNA A 100.0
/100.0		 14
/14		 R1AB_SARS2 Replicase polyprotein 1ab
7ozu E Template RNA A 100.0
/100.0		 30
/30		 R1AB_SARS2 Replicase polyprotein 1ab
7ozv E Template RNA A 100.0
/100.0		 28
/28		 R1AB_SARS2 Replicase polyprotein 1ab
7ozv D Product RNA A 100.0
/100.0		 12
/12		 R1AB_SARS2 Replicase polyprotein 1ab
7rdx H Template RNA A 100.0
/100.0		 34
/34		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy H Template RNA A 100.0
/100.0		 32
/32		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz H Template RNA A 100.0
/100.0		 31
/31		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 H Template RNA A 100.0
/100.0		 31
/31		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 H Template RNA A 100.0
/100.0		 30
/30		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 G Template RNA A 100.0
/100.0		 31
/31		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 I Template RNA A 100.0
/100.0		 32
/32		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 P Template RNA J 100.0
/100.0		 32
/32		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 E Product RNA (35-MER) A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 F Template RNA (55-MER) A 100.0
/100.0		 28
/28		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 D Product RNA (35-MER) A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 E Template RNA (55-MER) A 100.0
/100.0		 27
/27		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 D Product RNA (35-MER) A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 E Template RNA (55-MER) A 100.0
/100.0		 34
/34		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 G Template RNA A 100.0
/100.0		 31
/31		 R1AB_SARS2 RNA-directed RNA polymerase
7uob E Product RNA (35-MER) A 100.0
/100.0		 10
/10		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe E Product RNA (35-MER) A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7uob F Template RNA (55-MER) A 100.0
/100.0		 24
/24		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe F Template RNA (55-MER) A 100.0
/100.0		 30
/30		 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 F Template A 100.0
/99.9		 23
/23		 R1AB_SARS2 Replicase polyprotein 1ab
8gwk F template A 100.0
/100.0		 24
/24		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm I RNA (26-MER) A 100.0
/100.0		 22
/22		 R1AB_SARS2 RNA-directed RNA polymerase
8gwb H RNA (5'-R(P*AP*U)-3') A 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
8gwb J template A 100.0
/100.0		 27
/27		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf F template A 100.0
/100.0		 22
/22		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg F Template A 100.0
/100.0		 22
/22		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi F RNA (27-MER) A 100.0
/100.0		 22
/22		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn F template A 100.0
/100.0		 24
/24		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo F template A 100.0
/100.0		 26
/26		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe H RNA (5'-R(P*AP*UP*UP*A)-3') A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 F Primer RNA A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj F Primer RNA A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj G Template RNA A 100.0
/100.0		 23
/23		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj H SARS-CoV-2 5' UTR A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
8sqk F Primer RNA A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
8sqk G Template RNA A 100.0
/100.0		 23
/23		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
8sqk H SARS-CoV-2 5' UTR A 100.0
/100.0		 8
/8		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7cxm F RNA (26-MER) A 100.0
/99.9		 23
/23		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn F Template RNA A 100.0
/99.9		 20
/20		 R1AB_SARS2 RNA-directed RNA polymerase
8g6r D RNA (5'-R(P*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*UP*AP*AP.. A 93.8
/60.9		 16
/16		 A0A0U2C263_9ALPC nsp12
8g6r E RNA (5'-R(P*GP*GP*UP*UP*GP*UP*GP*AP*UP*UP*UP*UP*AP.. A 77.8
/60.9		 27
/27		 A0A0U2C263_9ALPC nsp12
8urb E RNA (33-MER) A 93.8
/60.7		 16
/16		 U6BRU0_9ALPC nsp12
8urb F RNA (55-MER) A 76.2
/60.7		 21
/21		 U6BRU0_9ALPC nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
7krn K ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7kro L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
7krp J ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 K ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 T ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 KA ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		J 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
6xez M 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
6xez N 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
6xez U 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7krn L 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7krn M 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7krn T 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7kro M 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7kro N 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7kro U 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7krp K 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7krp L 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7krp M 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx M 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx N 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx U 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy M 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy N 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy O 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 M 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 N 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 U 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 L 1N7
CHAPSO[35 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 M 1N7
CHAPSO[26 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 T 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 AA 1N7
CHAPSO[36 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 RA 1N7
CHAPSO[36 atoms] 		J 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7aap M GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 12
7ctt J GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f.. 		A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
7bv2 K F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk T F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq L GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 RNA-directed RNA polymerase
7d4f G H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal.. 		D 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7d4f H H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal.. 		D 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg G 1RP
6-fluoro-3-oxo-4-(5-O-phosphono-beta-D-ribofuranos.. 		C 100.0
/100.0		 7
/7		 R1AB_SARS2 RNA-directed RNA polymerase
7dfh N RVP
RIBAVIRIN MONOPHOSPHATE[20 atoms] 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymeras
7doi O HCU
[(2R)-4-(2-azanyl-6-oxidanylidene-3H-purin-9-yl)-2.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7dok G HCU
[(2R)-4-(2-azanyl-6-oxidanylidene-3H-purin-9-yl)-2.. 		C 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 J AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 K AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur.. 		A 100.0
/100.0		 11
/11		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 N AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 G NWX
[[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 G ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 J UTP
URIDINE 5'-TRIPHOSPHATE [29 atoms] 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
7uob L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
7uob M GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		A 100.0
/100.0		 19
/19		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
7uob N L2B
3'-DEOXYURIDINE-5'-MONOPHOSPHATE[19 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe L L2B
3'-DEOXYURIDINE-5'-MONOPHOSPHATE[19 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe K CTP
CYTIDINE-5'-TRIPHOSPHATE[29 atoms] 		A 100.0
/100.0		 14
/14		 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 T U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] 		A 100.0
/99.9		 8
/8		 R1AB_SARS2 Replicase polyprotein 1ab
8gwo S U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe M GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. 		A 100.0
/100.0		 13
/13		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk L GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm L GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn L GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo L GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. 		A 100.0
/100.0		 18
/18		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm S 6GS
2'-deoxy-2'-fluoro-2'-methyluridine 5'-(trihydroge.. 		A 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
8gy6 E GO3
Gossypol[38 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
8gy6 F GO3
Gossypol[38 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 L WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. 		A 100.0
/100.0		 15
/15		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 O WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. 		A 100.0
/100.0		 12
/12		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj I VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan.. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
8sqk I VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan.. 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
8sqk J VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan.. 		A 100.0
/100.0		 17
/17		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
6xqb I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7aap I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 12
7aap J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 12
7bv2 I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7bv2 J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq M MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg K MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg L MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg N MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg O MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7dfh I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymeras
7dfh J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymeras
7dfh K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymeras
7doi J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7doi K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7doi L MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7doi M MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7dok H MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7dok L MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7dok M MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7dok N MG
MAGNESIUM ION[1 atoms] 		C 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 L MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 M MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
7krn J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7kro K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7krp I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 S MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 JA MG
MAGNESIUM ION[1 atoms] 		J 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 H MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 H MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7uob I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7uob J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7uob K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe N MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk M MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 K MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 M MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 N MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj J MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8sqk M MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7thm H MN
MANGANESE (II) ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
8gw1 L MN
MANGANESE (II) ION[1 atoms] 		A 100.0
/99.9		 2
/2		 R1AB_SARS2 Replicase polyprotein 1ab
8gw1 M MN
MANGANESE (II) ION[1 atoms] 		A 100.0
/99.9		 3
/3		 R1AB_SARS2 Replicase polyprotein 1ab
8gwb M MN
MANGANESE (II) ION[1 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
8gwb N MN
MANGANESE (II) ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
6nur E ZN
ZINC ION[1 atoms] 		A 100.0
/97.0		 4
/4		 R1AB_CVHSA NSP12
6nur F ZN
ZINC ION[1 atoms] 		A 100.0
/97.0		 4
/4		 R1AB_CVHSA NSP12
6nus C ZN
ZINC ION[1 atoms] 		A 100.0
/96.6		 4
/4		 R1AB_CVHSA NSP12
6nus D ZN
ZINC ION[1 atoms] 		A 100.0
/96.6		 4
/4		 R1AB_CVHSA NSP12
6xez I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
6xez J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
6xqb G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
6xqb H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
6yyt I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp12
6yyt J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 nsp12
7aap G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 12
7aap H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 12
7b3b F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3b G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3d F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7b3d G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7btf E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7btf F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7bv1 E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7bv1 F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7bv2 F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7bv2 G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7bw4 E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7bw4 F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7bzf G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7bzf H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7c2k G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7c2k H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7ctt H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7cxm J ZN
ZINC ION[1 atoms] 		A 100.0
/99.9		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7cxm K ZN
ZINC ION[1 atoms] 		A 100.0
/99.9		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn J ZN
ZINC ION[1 atoms] 		A 100.0
/99.9		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7cxn K ZN
ZINC ION[1 atoms] 		A 100.0
/99.9		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7cyq K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7d4f E ZN
ZINC ION[1 atoms] 		D 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7d4f F ZN
ZINC ION[1 atoms] 		D 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg H ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg I ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7dfh G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymeras
7dfh H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymeras
7doi G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7doi H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7dok I ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7dok J ZN
ZINC ION[1 atoms] 		C 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7dte G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7dte H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7ed5 H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7egq W ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7egq X ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7egq IA ZN
ZINC ION[1 atoms] 		I 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7egq JA ZN
ZINC ION[1 atoms] 		I 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz L ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7eiz M ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7krn H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7krn I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7kro I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7kro J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7krp G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7krp H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7oyg K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7oyg L ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7oyg M ZN
ZINC ION[1 atoms] 		F 100.0
/100.0		 4
/4		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7oyg N ZN
ZINC ION[1 atoms] 		F 100.0
/100.0		 4
/4		 R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7ozu F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
7ozu G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Replicase polyprotein 1ab
7ozv F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
7ozv G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
7rdx I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7rdx J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7rdy J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7rdz J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7re0 J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7re1 J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7re2 I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 Q ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 R ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 HA ZN
ZINC ION[1 atoms] 		J 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 IA ZN
ZINC ION[1 atoms] 		J 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7thm F ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7thm G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uo4 J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uo7 J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uo9 H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uob G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uob H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe G ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7uoe H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
8g6r F ZN
ZINC ION[1 atoms] 		A 100.0
/60.9		 4
/4		 A0A0U2C263_9ALPC nsp12
8g6r G ZN
ZINC ION[1 atoms] 		A 100.0
/60.9		 4
/4		 A0A0U2C263_9ALPC nsp12
8gw1 J ZN
ZINC ION[1 atoms] 		A 100.0
/99.9		 4
/4		 R1AB_SARS2 Replicase polyprotein 1ab
8gw1 K ZN
ZINC ION[1 atoms] 		A 100.0
/99.9		 5
/5		 R1AB_SARS2 Replicase polyprotein 1ab
8gwb K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwb L ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwe L ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwf K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwg K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwi K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwk K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwm K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwn K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo J ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8gwo K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 H ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8sq9 I ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8sqj L ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
8sqk K ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
8sqk L ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase nsp12
8urb G ZN
ZINC ION[1 atoms] 		A 100.0
/60.7		 4
/4		 U6BRU0_9ALPC nsp12
8urb H ZN
ZINC ION[1 atoms] 		A 100.0
/60.7		 4
/4		 U6BRU0_9ALPC nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7egq I R1AB_SARS2 RNA-directed RNA polymerase[926 aa] A 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7egq A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] I 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] A 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
7re3 A R1AB_SARS2 RNA-directed RNA polymerase[927 aa] J 100.0
/100.0		 9
/9		 R1AB_SARS2 RNA-directed RNA polymerase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
932 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7aap K POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 12
7bv2 H POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg J POP
PYROPHOSPHATE 2-[9 atoms] 		C 100.0
/100.0		 4
/4		 R1AB_SARS2 RNA-directed RNA polymerase
7dfg M POP
PYROPHOSPHATE 2-[9 atoms] 		C 100.0
/100.0		 7
/7		 R1AB_SARS2 RNA-directed RNA polymerase
7dfh L POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymeras
7dfh M POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 RNA-directed RNA polymeras
7doi I POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7doi N POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 RNA-directed RNA polymerase
7dok K POP
PYROPHOSPHATE 2-[9 atoms] 		C 100.0
/100.0		 5
/5		 R1AB_SARS2 RNA-directed RNA polymerase
7dok O POP
PYROPHOSPHATE 2-[9 atoms] 		C 100.0
/100.0		 7
/7		 R1AB_SARS2 RNA-directed RNA polymerase
7thm I POP
PYROPHOSPHATE 2-[9 atoms] 		A 100.0
/100.0		 2
/2		 R1AB_SARS2 RNA-directed RNA polymerase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.