#WARNING:no index is registered index "YP_009725305.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725305.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4624 113 66 YP_009725305.1()
QUERYSEQ 
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725305.1()]

113
region name description
1-8 DISORDER predicted by DISOPRED

MONOMER
113
pdb_id a1 identity[%]2 description
6w4b B 100.0 R1AB_SARS2 Non-structural protein 9
7kri B 100.0 R1AB_SARS2 Non-structural protein 9
7kri A 100.0 R1AB_SARS2 Non-structural protein 9
7n3k G 100.0 R1AB_SARS2 Non-structural protein 9
8gwm G 100.0 R1AB_SARS2 Non-structural protein 9
8gwk I 100.0 R1AB_SARS2 Non-structural protein 9
8gwe G 100.0 R1AB_SARS2 Non-structural protein 9
8sqj E 100.0 R1AB_SARS2 Non-structural protein 9
8gwo I 100.0 R1AB_SARS2 Non-structural protein 9
8gwn I 100.0 R1AB_SARS2 Non-structural protein 9
8sqk E 100.0 R1AB_SARS2 Non-structural protein 9
7eiz E 100.0 R1AB_SARS2 Non-structural protein 9
8gwi I 100.0 R1AB_SARS2 Non-structural protein 9
8gw1 I 100.0 R1AB_SARS2 Non-structural protein 9
6wxd A 100.0 R1AB_SARS2 Non-structural protein 9
8gwb G 100.0 R1AB_SARS2 Non-structural protein 9
7egq F 100.0 R1AB_SARS2 Non-structural protein 9
7egq N 100.0 R1AB_SARS2 Non-structural protein 9
8gwf I 100.0 R1AB_SARS2 Non-structural protein 9
8gwg I 100.0 R1AB_SARS2 Non-structural protein 9
7cyq I 100.0 R1AB_SARS2 Non-structural protein 9
7n3k C 100.0 R1AB_SARS2 Non-structural protein 9
7n3k B 100.0 R1AB_SARS2 Non-structural protein 9
7n3k D 100.0 R1AB_SARS2 Non-structural protein 9
7n3k F 100.0 R1AB_SARS2 Non-structural protein 9
7n3k H 100.0 R1AB_SARS2 Non-structural protein 9
7n3k E 100.0 R1AB_SARS2 Non-structural protein 9
7n3k A 100.0 R1AB_SARS2 Non-structural protein 9
6w9q A 100.0 R1AB_SARS2 3C-like proteinase peptide, Non-structural protein 9 fusion
7kri C 100.0 R1AB_SARS2 Non-structural protein 9
6wc1 A 100.0 SARS-coV-2 Non-structural protein 9
6wc1 B 100.0 SARS-coV-2 Non-structural protein 9
1uw7 A 97.3 R1AB_CVHSA NSP9
6wxd B 100.0 R1AB_SARS2 Non-structural protein 9
6w4b A 100.0 R1AB_SARS2 Non-structural protein 9
1qz8 A 97.3 R1AB_CVHSA polyprotein 1ab
7bwq F 100.0 Nsp9
7bwq E 100.0 Nsp9
7bwq A 100.0 Nsp9
7bwq B 100.0 Nsp9
1qz8 B 97.3 R1AB_CVHSA polyprotein 1ab
7bwq C 100.0 Nsp9
7bwq D 100.0 Nsp9
3ee7 B 96.3 R1A_CVHSA Replicase polyprotein 1a
3ee7 D 96.3 R1A_CVHSA Replicase polyprotein 1a
3ee7 C 96.3 R1A_CVHSA Replicase polyprotein 1a
3ee7 A 96.2 R1A_CVHSA Replicase polyprotein 1a
8sq9 E 100.0 R1AB_SARS2 Non-structural protein 9
8dqu C 100.0 R1AB_SARS2 Non-structural protein 9
8dqu D 100.0 R1AB_SARS2 Non-structural protein 9
7thm E 100.0 R1AB_SARS2 Non-structural protein 9
2j97 A 54.9 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j98 A 43.4 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j98 B 50.0 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
5c94 A 39.6 R1AB_IBVM Non-structural protein 9
5hiz A 50.0 R1AB_PEDV7 Non-structural protein 9
5hiz B 50.0 R1AB_PEDV7 Non-structural protein 9
5hiy B 44.8 R1AB_PEDV7 Non-structural protein 9
5hiy A 49.3 R1AB_PEDV7 Non-structural protein 9
5hiy C 50.7 R1AB_PEDV7 Non-structural protein 9
5ym6 B 38.1 X2G6C4_9NIDO nsp9
5ym6 A 38.5 X2G6C4_9NIDO nsp9
5ym6 C 38.1 X2G6C4_9NIDO nsp9
5ym6 D 38.3 X2G6C4_9NIDO nsp9
5ym8 A 40.0 X2G6C4_9NIDO nsp9
5ym8 B 36.4 X2G6C4_9NIDO nsp9 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cyq A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] I 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 9
7egq A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] F 100.0
/100.0		 13
/13		 R1AB_SARS2 Non-structural protein 9
7egq I R1AB_SARS2 RNA-directed RNA polymerase[926 aa] N 100.0
/100.0		 13
/13		 R1AB_SARS2 Non-structural protein 9
7eiz A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] E 100.0
/100.0		 11
/11		 R1AB_SARS2 Non-structural protein 9
7thm A R1AB_SARS2 RNA-directed RNA polymerase[860 aa] E 100.0
/100.0		 11
/11		 R1AB_SARS2 Non-structural protein 9
8gw1 A R1AB_SARS2 Replicase polyprotein 1ab[928 aa] I 100.0
/100.0		 11
/11		 R1AB_SARS2 Non-structural protein 9
8gwb A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] G 100.0
/100.0		 11
/11		 R1AB_SARS2 Non-structural protein 9
8gwe A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] G 100.0
/100.0		 13
/13		 R1AB_SARS2 Non-structural protein 9
8gwf A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] I 100.0
/100.0		 13
/13		 R1AB_SARS2 Non-structural protein 9
8gwg A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] I 100.0
/100.0		 13
/13		 R1AB_SARS2 Non-structural protein 9
8gwi A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] I 100.0
/100.0		 13
/13		 R1AB_SARS2 Non-structural protein 9
8gwk A R1AB_SARS2 RNA-directed RNA polymerase[931 aa] I 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 9
8gwm A R1AB_SARS2 RNA-directed RNA polymerase[928 aa] G 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 9
8gwn A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] I 100.0
/100.0		 10
/10		 R1AB_SARS2 Non-structural protein 9
8gwo A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] I 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 9
8sq9 A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] E 100.0
/100.0		 14
/14		 R1AB_SARS2 Non-structural protein 9
8sqj A R1AB_SARS2 RNA-directed RNA polymerase[929 aa] E 100.0
/100.0		 14
/14		 R1AB_SARS2 Non-structural protein 9
8sqk A R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] E 100.0
/100.0		 12
/12		 R1AB_SARS2 Non-structural protein 9
7egq G R1AB_SARS2 Non-structural protein 10[131 aa] F 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7egq O R1AB_SARS2 Non-structural protein 10[130 aa] N 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7egq H R1AB_SARS2 Proofreading exoribonuclease[523 aa] F 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7egq P R1AB_SARS2 Proofreading exoribonuclease[524 aa] N 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7eiz I R1AB_SARS2 Proofreading exoribonuclease[523 aa] E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8dqu A Nanobody[127 aa] C 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu A Nanobody[127 aa] C 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu A Nanobody[127 aa] C 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu A Nanobody[127 aa] C 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu A Nanobody[127 aa] C 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu A Nanobody[127 aa] C 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu B Nanobody[126 aa] D 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu B Nanobody[126 aa] D 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu B Nanobody[126 aa] D 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu B Nanobody[126 aa] D 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu B Nanobody[126 aa] D 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
8dqu B Nanobody[126 aa] D 100.0
/100.0		 15
/15		 R1AB_SARS2 Non-structural protein 9
2j98 B R1A_CVH22 REPLICASE POLYPROTEIN 1AB[102 aa] A 66.7
/43.4		 15
/15		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j98 A R1A_CVH22 REPLICASE POLYPROTEIN 1AB[106 aa] B 72.7
/50.0		 11
/14		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8gwb H RNA (5'-R(P*AP*U)-3') G 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwe H RNA (5'-R(P*AP*UP*UP*A)-3') G 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8sqj H SARS-CoV-2 5' UTR E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8sqk H SARS-CoV-2 5' UTR E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cyq L GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri E X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		A 100.0
/100.0		 6
/7		 R1AB_SARS2 Non-structural protein 9
7kri E X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		A 100.0
/100.0		 6
/7		 R1AB_SARS2 Non-structural protein 9
7kri F X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		A 100.0
/100.0		 3
/4		 R1AB_SARS2 Non-structural protein 9
7kri F X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		A 100.0
/100.0		 3
/4		 R1AB_SARS2 Non-structural protein 9
7kri H X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		B 100.0
/100.0		 5
/6		 R1AB_SARS2 Non-structural protein 9
7kri H X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		B 100.0
/100.0		 5
/6		 R1AB_SARS2 Non-structural protein 9
7kri I X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		B 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7kri I X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		B 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7kri L X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		C 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 9
7kri L X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		C 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 9
7kri M X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		C 100.0
/100.0		 3
/4		 R1AB_SARS2 Non-structural protein 9
7kri M X0Y
1,3-dimethyl-1H-pyrrolo[3,4-d]pyrimidine-2,4(3H,6H.. 		C 100.0
/100.0		 3
/4		 R1AB_SARS2 Non-structural protein 9
7n3k I ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 9
7n3k J ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		A 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7n3k I ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		B 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7n3k J ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		B 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 9
7n3k L ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		C 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 9
7n3k M ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		C 100.0
/100.0		 1
/2		 R1AB_SARS2 Non-structural protein 9
7n3k L ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		D 100.0
/100.0		 3
/4		 R1AB_SARS2 Non-structural protein 9
7n3k M ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		D 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 9
7n3k O ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		E 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 9
7n3k P ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		E 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7n3k O ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		F 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7n3k P ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		F 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 9
7n3k R ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		G 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 9
7n3k T ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		G 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7n3k R ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		H 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7n3k T ODN
(1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14.. 		H 100.0
/100.0		 6
/6		 R1AB_SARS2 Non-structural protein 9
8gw1 T U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwo S U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwf L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwg L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwi L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwk T F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-.. 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8gwm S 6GS
2'-deoxy-2'-fluoro-2'-methyluridine 5'-(trihydroge.. 		G 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8sq9 O WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph.. 		E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cyq M MG
MAGNESIUM ION[1 atoms] 		I 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
8sq9 N MG
MAGNESIUM ION[1 atoms] 		E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1qz8 A R1AB_CVHSA polyprotein 1ab[111 aa] A 100.0
/97.3		 6
/6		 R1AB_CVHSA polyprotein 1ab
1qz8 A R1AB_CVHSA polyprotein 1ab[111 aa] A 100.0
/97.3		 6
/6		 R1AB_CVHSA polyprotein 1ab
1qz8 B R1AB_CVHSA polyprotein 1ab[110 aa] A 100.0
/97.3		 17
/17		 R1AB_CVHSA polyprotein 1ab
1qz8 B R1AB_CVHSA polyprotein 1ab[110 aa] A 100.0
/97.3		 17
/17		 R1AB_CVHSA polyprotein 1ab
1qz8 A R1AB_CVHSA polyprotein 1ab[111 aa] B 100.0
/97.3		 17
/17		 R1AB_CVHSA polyprotein 1ab
1qz8 A R1AB_CVHSA polyprotein 1ab[111 aa] B 100.0
/97.3		 17
/17		 R1AB_CVHSA polyprotein 1ab
1uw7 A R1AB_CVHSA NSP9[122 aa] A 100.0
/97.3		 21
/24		 R1AB_CVHSA NSP9
1uw7 A R1AB_CVHSA NSP9[122 aa] A 100.0
/97.3		 21
/24		 R1AB_CVHSA NSP9
3ee7 B R1A_CVHSA Replicase polyprotein 1a[115 aa] A 92.9
/96.2		 14
/14		 R1A_CVHSA Replicase polyprotein 1a
3ee7 A R1A_CVHSA Replicase polyprotein 1a[106 aa] B 93.3
/96.3		 15
/17		 R1A_CVHSA Replicase polyprotein 1a
3ee7 D R1A_CVHSA Replicase polyprotein 1a[112 aa] C 93.3
/96.3		 15
/17		 R1A_CVHSA Replicase polyprotein 1a
3ee7 C R1A_CVHSA Replicase polyprotein 1a[110 aa] D 91.7
/96.3		 12
/14		 R1A_CVHSA Replicase polyprotein 1a
6w4b B R1AB_SARS2 Non-structural protein 9[116 aa] A 100.0
/100.0		 16
/16		 R1AB_SARS2 Non-structural protein 9
6w4b A R1AB_SARS2 Non-structural protein 9[109 aa] B 100.0
/100.0		 17
/18		 R1AB_SARS2 Non-structural protein 9
6w9q A R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. A 100.0
/100.0		 20
/24		 R1AB_SARS2 3C-like proteinase peptide, Non-structural protein..
6w9q A R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. A 100.0
/100.0		 20
/24		 R1AB_SARS2 3C-like proteinase peptide, Non-structural protein..
6wc1 B SARS-coV-2 Non-structural protein 9[111 aa] A 100.0
/100.0		 18
/18		 SARS-coV-2 Non-structural protein 9
6wc1 A SARS-coV-2 Non-structural protein 9[112 aa] B 100.0
/100.0		 22
/22		 SARS-coV-2 Non-structural protein 9
6wxd B R1AB_SARS2 Non-structural protein 9[110 aa] A 100.0
/100.0		 18
/18		 R1AB_SARS2 Non-structural protein 9
6wxd A R1AB_SARS2 Non-structural protein 9[113 aa] B 100.0
/100.0		 19
/19		 R1AB_SARS2 Non-structural protein 9
7bwq B Nsp9[108 aa] A 100.0
/100.0		 13
/13		 Nsp9
7bwq A Nsp9[108 aa] B 100.0
/100.0		 11
/11		 Nsp9
7bwq D Nsp9[106 aa] C 100.0
/100.0		 10
/10		 Nsp9
7bwq C Nsp9[107 aa] D 100.0
/100.0		 10
/10		 Nsp9
7bwq F Nsp9[108 aa] E 100.0
/100.0		 12
/12		 Nsp9
7bwq E Nsp9[108 aa] F 100.0
/100.0		 13
/13		 Nsp9
7kri B R1AB_SARS2 Non-structural protein 9[127 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri B R1AB_SARS2 Non-structural protein 9[127 aa] A 100.0
/100.0		 19
/22		 R1AB_SARS2 Non-structural protein 9
7kri B R1AB_SARS2 Non-structural protein 9[127 aa] A 100.0
/100.0		 19
/22		 R1AB_SARS2 Non-structural protein 9
7kri B R1AB_SARS2 Non-structural protein 9[127 aa] A 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri C R1AB_SARS2 Non-structural protein 9[123 aa] A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 9
7kri C R1AB_SARS2 Non-structural protein 9[123 aa] A 100.0
/100.0		 15
/18		 R1AB_SARS2 Non-structural protein 9
7kri C R1AB_SARS2 Non-structural protein 9[123 aa] A 100.0
/100.0		 15
/18		 R1AB_SARS2 Non-structural protein 9
7kri C R1AB_SARS2 Non-structural protein 9[123 aa] A 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 9
7kri A R1AB_SARS2 Non-structural protein 9[127 aa] B 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 9
7kri A R1AB_SARS2 Non-structural protein 9[127 aa] B 100.0
/100.0		 19
/22		 R1AB_SARS2 Non-structural protein 9
7kri A R1AB_SARS2 Non-structural protein 9[127 aa] B 100.0
/100.0		 19
/22		 R1AB_SARS2 Non-structural protein 9
7kri A R1AB_SARS2 Non-structural protein 9[127 aa] B 100.0
/100.0		 2
/2		 R1AB_SARS2 Non-structural protein 9
7kri B R1AB_SARS2 Non-structural protein 9[127 aa] B 100.0
/100.0		 11
/14		 R1AB_SARS2 Non-structural protein 9
7kri B R1AB_SARS2 Non-structural protein 9[127 aa] B 100.0
/100.0		 11
/14		 R1AB_SARS2 Non-structural protein 9
7kri C R1AB_SARS2 Non-structural protein 9[123 aa] B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 9
7kri C R1AB_SARS2 Non-structural protein 9[123 aa] B 100.0
/100.0		 5
/5		 R1AB_SARS2 Non-structural protein 9
7kri A R1AB_SARS2 Non-structural protein 9[127 aa] C 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 9
7kri A R1AB_SARS2 Non-structural protein 9[127 aa] C 100.0
/100.0		 19
/22		 R1AB_SARS2 Non-structural protein 9
7kri A R1AB_SARS2 Non-structural protein 9[127 aa] C 100.0
/100.0		 19
/22		 R1AB_SARS2 Non-structural protein 9
7kri A R1AB_SARS2 Non-structural protein 9[127 aa] C 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 9
7kri B R1AB_SARS2 Non-structural protein 9[127 aa] C 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 9
7kri B R1AB_SARS2 Non-structural protein 9[127 aa] C 100.0
/100.0		 4
/4		 R1AB_SARS2 Non-structural protein 9
7kri C R1AB_SARS2 Non-structural protein 9[123 aa] C 100.0
/100.0		 20
/23		 R1AB_SARS2 Non-structural protein 9
7kri C R1AB_SARS2 Non-structural protein 9[123 aa] C 100.0
/100.0		 20
/23		 R1AB_SARS2 Non-structural protein 9
7n3k B R1AB_SARS2 Non-structural protein 9[124 aa] A 100.0
/100.0		 21
/24		 R1AB_SARS2 Non-structural protein 9
7n3k A R1AB_SARS2 Non-structural protein 9[124 aa] B 100.0
/100.0		 19
/22		 R1AB_SARS2 Non-structural protein 9
7n3k D R1AB_SARS2 Non-structural protein 9[124 aa] C 100.0
/100.0		 20
/22		 R1AB_SARS2 Non-structural protein 9
7n3k C R1AB_SARS2 Non-structural protein 9[124 aa] D 100.0
/100.0		 18
/20		 R1AB_SARS2 Non-structural protein 9
7n3k F R1AB_SARS2 Non-structural protein 9[124 aa] E 100.0
/100.0		 21
/24		 R1AB_SARS2 Non-structural protein 9
7n3k E R1AB_SARS2 Non-structural protein 9[124 aa] F 100.0
/100.0		 19
/23		 R1AB_SARS2 Non-structural protein 9
7n3k H R1AB_SARS2 Non-structural protein 9[124 aa] G 100.0
/100.0		 20
/22		 R1AB_SARS2 Non-structural protein 9
7n3k G R1AB_SARS2 Non-structural protein 9[121 aa] H 100.0
/100.0		 17
/20		 R1AB_SARS2 Non-structural protein 9
8dqu D R1AB_SARS2 Non-structural protein 9[74 aa] C 100.0
/100.0		 26
/26		 R1AB_SARS2 Non-structural protein 9
8dqu D R1AB_SARS2 Non-structural protein 9[74 aa] C 100.0
/100.0		 26
/26		 R1AB_SARS2 Non-structural protein 9
8dqu D R1AB_SARS2 Non-structural protein 9[74 aa] C 100.0
/100.0		 26
/26		 R1AB_SARS2 Non-structural protein 9
8dqu D R1AB_SARS2 Non-structural protein 9[74 aa] C 100.0
/100.0		 26
/26		 R1AB_SARS2 Non-structural protein 9
8dqu D R1AB_SARS2 Non-structural protein 9[74 aa] C 100.0
/100.0		 26
/26		 R1AB_SARS2 Non-structural protein 9
8dqu D R1AB_SARS2 Non-structural protein 9[74 aa] C 100.0
/100.0		 26
/26		 R1AB_SARS2 Non-structural protein 9
8dqu C R1AB_SARS2 Non-structural protein 9[78 aa] D 100.0
/100.0		 24
/24		 R1AB_SARS2 Non-structural protein 9
8dqu C R1AB_SARS2 Non-structural protein 9[78 aa] D 100.0
/100.0		 24
/24		 R1AB_SARS2 Non-structural protein 9
8dqu C R1AB_SARS2 Non-structural protein 9[78 aa] D 100.0
/100.0		 24
/24		 R1AB_SARS2 Non-structural protein 9
8dqu C R1AB_SARS2 Non-structural protein 9[78 aa] D 100.0
/100.0		 24
/24		 R1AB_SARS2 Non-structural protein 9
8dqu C R1AB_SARS2 Non-structural protein 9[78 aa] D 100.0
/100.0		 24
/24		 R1AB_SARS2 Non-structural protein 9
8dqu C R1AB_SARS2 Non-structural protein 9[78 aa] D 100.0
/100.0		 24
/24		 R1AB_SARS2 Non-structural protein 9
2j97 A R1A_CVH22 REPLICASE POLYPROTEIN 1AB[98 aa] A 86.4
/54.9		 22
/22		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j97 A R1A_CVH22 REPLICASE POLYPROTEIN 1AB[98 aa] A 86.4
/54.9		 22
/22		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
5hiy B R1AB_PEDV7 Non-structural protein 9[96 aa] A 44.4
/49.3		 9
/10		 R1AB_PEDV7 Non-structural protein 9
5hiy A R1AB_PEDV7 Non-structural protein 9[95 aa] B 66.7
/44.8		 9
/9		 R1AB_PEDV7 Non-structural protein 9
5hiy C R1AB_PEDV7 Non-structural protein 9[93 aa] C 57.1
/50.7		 7
/7		 R1AB_PEDV7 Non-structural protein 9
5hiy C R1AB_PEDV7 Non-structural protein 9[93 aa] C 57.1
/50.7		 7
/7		 R1AB_PEDV7 Non-structural protein 9
5hiz B R1AB_PEDV7 Non-structural protein 9[96 aa] A 55.6
/50.0		 9
/11		 R1AB_PEDV7 Non-structural protein 9
5hiz A R1AB_PEDV7 Non-structural protein 9[96 aa] B 66.7
/50.0		 9
/11		 R1AB_PEDV7 Non-structural protein 9
5c94 A R1AB_IBVM Non-structural protein 9[116 aa] A 64.7
/39.6		 17
/21		 R1AB_IBVM Non-structural protein 9
5c94 A R1AB_IBVM Non-structural protein 9[116 aa] A 64.7
/39.6		 17
/21		 R1AB_IBVM Non-structural protein 9
5ym6 B X2G6C4_9NIDO nsp9[99 aa] A 73.7
/38.5		 19
/19		 X2G6C4_9NIDO nsp9
5ym6 A X2G6C4_9NIDO nsp9[97 aa] B 70.0
/38.1		 20
/21		 X2G6C4_9NIDO nsp9
5ym6 D X2G6C4_9NIDO nsp9[95 aa] C 66.7
/38.1		 21
/22		 X2G6C4_9NIDO nsp9
5ym6 C X2G6C4_9NIDO nsp9[99 aa] D 72.2
/38.3		 18
/18		 X2G6C4_9NIDO nsp9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
113 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1qz8 C SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 2
/2		 R1AB_CVHSA polyprotein 1ab
1qz8 C SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 3
/3		 R1AB_CVHSA polyprotein 1ab
1qz8 C SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 3
/3		 R1AB_CVHSA polyprotein 1ab
1qz8 C SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 2
/2		 R1AB_CVHSA polyprotein 1ab
1qz8 D SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 1
/1		 R1AB_CVHSA polyprotein 1ab
1qz8 D SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 1
/1		 R1AB_CVHSA polyprotein 1ab
1qz8 D SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 1
/1		 R1AB_CVHSA polyprotein 1ab
1qz8 D SO4
SULFATE ION[5 atoms] 		A 100.0
/97.3		 1
/1		 R1AB_CVHSA polyprotein 1ab
1qz8 E SO4
SULFATE ION[5 atoms] 		A 66.7
/97.3		 3
/3		 R1AB_CVHSA polyprotein 1ab
1qz8 E SO4
SULFATE ION[5 atoms] 		A 66.7
/97.3		 3
/3		 R1AB_CVHSA polyprotein 1ab
1qz8 C SO4
SULFATE ION[5 atoms] 		B 100.0
/97.3		 1
/1		 R1AB_CVHSA polyprotein 1ab
1qz8 C SO4
SULFATE ION[5 atoms] 		B 100.0
/97.3		 1
/1		 R1AB_CVHSA polyprotein 1ab
1qz8 D SO4
SULFATE ION[5 atoms] 		B 100.0
/97.3		 3
/3		 R1AB_CVHSA polyprotein 1ab
1qz8 D SO4
SULFATE ION[5 atoms] 		B 100.0
/97.3		 3
/3		 R1AB_CVHSA polyprotein 1ab
1qz8 F SO4
SULFATE ION[5 atoms] 		B 50.0
/97.3		 2
/2		 R1AB_CVHSA polyprotein 1ab
1qz8 F SO4
SULFATE ION[5 atoms] 		B 50.0
/97.3		 2
/2		 R1AB_CVHSA polyprotein 1ab
2j97 C SO4
SULFATE ION[5 atoms] 		A 40.0
/54.9		 5
/5		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j97 C SO4
SULFATE ION[5 atoms] 		A 40.0
/54.9		 5
/5		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j97 D SO4
SULFATE ION[5 atoms] 		A 100.0
/54.9		 1
/2		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j97 D SO4
SULFATE ION[5 atoms] 		A 100.0
/54.9		 1
/2		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
6wc1 C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/2		 SARS-coV-2 Non-structural protein 9
6wxd C SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
6wxd D SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
6wxd E SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 7
/7		 R1AB_SARS2 Non-structural protein 9
7bwq G SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 3
/3		 Nsp9
7bwq H SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 5
/5		 Nsp9
7bwq G SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 1
/1		 Nsp9
7bwq I SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 4
/4		 Nsp9
7bwq J SO4
SULFATE ION[5 atoms] 		C 100.0
/100.0		 4
/4		 Nsp9
7bwq K SO4
SULFATE ION[5 atoms] 		E 100.0
/100.0		 2
/2		 Nsp9
7bwq K SO4
SULFATE ION[5 atoms] 		F 100.0
/100.0		 2
/2		 Nsp9
7kri D SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7kri D SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7kri G SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7kri G SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 2
/3		 R1AB_SARS2 Non-structural protein 9
7kri J SO4
SULFATE ION[5 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri J SO4
SULFATE ION[5 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7n3k K SO4
SULFATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7n3k K SO4
SULFATE ION[5 atoms] 		B 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7n3k N SO4
SULFATE ION[5 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7n3k N SO4
SULFATE ION[5 atoms] 		D 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7n3k Q SO4
SULFATE ION[5 atoms] 		E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7n3k Q SO4
SULFATE ION[5 atoms] 		F 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7n3k S SO4
SULFATE ION[5 atoms] 		G 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7n3k S SO4
SULFATE ION[5 atoms] 		H 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
3ee7 E PO4
PHOSPHATE ION[5 atoms] 		A 75.0
/96.2		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7 F PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/96.2		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7 G PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/96.2		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7 F PO4
PHOSPHATE ION[5 atoms] 		B 100.0
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7 M PO4
PHOSPHATE ION[5 atoms] 		B 66.7
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7 P PO4
PHOSPHATE ION[5 atoms] 		C 66.7
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7 W PO4
PHOSPHATE ION[5 atoms] 		C 100.0
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7 P PO4
PHOSPHATE ION[5 atoms] 		D 100.0
/96.3		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7 U PO4
PHOSPHATE ION[5 atoms] 		D 100.0
/96.3		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7 V PO4
PHOSPHATE ION[5 atoms] 		D 75.0
/96.3		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7 W PO4
PHOSPHATE ION[5 atoms] 		D 100.0
/96.3		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
6w9q B PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 3C-like proteinase peptide, Non-structural protein..
6w9q B PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 1
/1		 R1AB_SARS2 3C-like proteinase peptide, Non-structural protein..
7kri K MLI
MALONATE ION[7 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7kri K MLI
MALONATE ION[7 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7kri K MLI
MALONATE ION[7 atoms] 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri K MLI
MALONATE ION[7 atoms] 		B 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri K MLI
MALONATE ION[7 atoms] 		C 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7kri K MLI
MALONATE ION[7 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri K MLI
MALONATE ION[7 atoms] 		C 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
7kri K MLI
MALONATE ION[7 atoms] 		C 100.0
/100.0		 3
/3		 R1AB_SARS2 Non-structural protein 9
7thm I POP
PYROPHOSPHATE 2-[9 atoms] 		E 100.0
/100.0		 1
/1		 R1AB_SARS2 Non-structural protein 9
2j97 B MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		A 100.0
/54.9		 4
/5		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j97 B MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		A 100.0
/54.9		 4
/5		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
2j98 C DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] 		A 50.0
/43.4		 6
/6		 R1A_CVH22 REPLICASE POLYPROTEIN 1AB
3ee7 H GOL
GLYCEROL[6 atoms] 		A 100.0
/96.2		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7 I GOL
GLYCEROL[6 atoms] 		A 75.0
/96.2		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7 J GOL
GLYCEROL[6 atoms] 		A 100.0
/96.2		 6
/6		 R1A_CVHSA Replicase polyprotein 1a
3ee7 K GOL
GLYCEROL[6 atoms] 		A 100.0
/96.2		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7 K GOL
GLYCEROL[6 atoms] 		B 100.0
/96.3		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7 L GOL
GLYCEROL[6 atoms] 		B 100.0
/96.3		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7 N GOL
GLYCEROL[6 atoms] 		B 100.0
/96.3		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7 O GOL
GLYCEROL[6 atoms] 		B 100.0
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7 AA GOL
GLYCEROL[6 atoms] 		C 100.0
/96.3		 1
/1		 R1A_CVHSA Replicase polyprotein 1a
3ee7 Q GOL
GLYCEROL[6 atoms] 		C 100.0
/96.3		 5
/5		 R1A_CVHSA Replicase polyprotein 1a
3ee7 R GOL
GLYCEROL[6 atoms] 		C 100.0
/96.3		 2
/2		 R1A_CVHSA Replicase polyprotein 1a
3ee7 S GOL
GLYCEROL[6 atoms] 		C 100.0
/96.3		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7 T GOL
GLYCEROL[6 atoms] 		C 100.0
/96.3		 2
/2		 R1A_CVHSA Replicase polyprotein 1a
3ee7 AA GOL
GLYCEROL[6 atoms] 		D 100.0
/96.3		 2
/2		 R1A_CVHSA Replicase polyprotein 1a
3ee7 BA GOL
GLYCEROL[6 atoms] 		D 100.0
/96.3		 2
/2		 R1A_CVHSA Replicase polyprotein 1a
3ee7 X GOL
GLYCEROL[6 atoms] 		D 100.0
/96.3		 4
/4		 R1A_CVHSA Replicase polyprotein 1a
3ee7 Y GOL
GLYCEROL[6 atoms] 		D 100.0
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
3ee7 Z GOL
GLYCEROL[6 atoms] 		D 66.7
/96.3		 3
/3		 R1A_CVHSA Replicase polyprotein 1a
5c94 D GOL
GLYCEROL[6 atoms] 		A 25.0
/39.6		 4
/4		 R1AB_IBVM Non-structural protein 9
5c94 D GOL
GLYCEROL[6 atoms] 		A 0.0
/39.6		 1
/1		 R1AB_IBVM Non-structural protein 9
5c94 D GOL
GLYCEROL[6 atoms] 		A 0.0
/39.6		 1
/1		 R1AB_IBVM Non-structural protein 9
5c94 D GOL
GLYCEROL[6 atoms] 		A 25.0
/39.6		 4
/4		 R1AB_IBVM Non-structural protein 9
5c94 B PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 25.0
/39.6		 4
/4		 R1AB_IBVM Non-structural protein 9
5c94 B PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 25.0
/39.6		 4
/4		 R1AB_IBVM Non-structural protein 9
5c94 C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 80.0
/39.6		 5
/5		 R1AB_IBVM Non-structural protein 9
5c94 C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 40.0
/39.6		 5
/5		 R1AB_IBVM Non-structural protein 9
5c94 C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 40.0
/39.6		 5
/5		 R1AB_IBVM Non-structural protein 9
5c94 C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] 		A 80.0
/39.6		 5
/5		 R1AB_IBVM Non-structural protein 9
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.