Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
3652451 | 207 | 30 | P51149(RAB7A_HUMAN) | RecName: Full=Ras-related protein Rab-7a ; EC=3.6.5.2 ; |
QUERYSEQ |
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIP YFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC |
207 | region | name | description |
2-207 | CHAIN | /note="Ras-related protein Rab-7a" /id="PRO_0000121121" | |
15-22 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" | |
34-40 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" | |
63-67 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" | |
125-128 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" | |
156-157 | BINDING | /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269|PubMed:20028791" | |
205-205 | LIPID | /note="S-geranylgeranyl cysteine" | |
207-207 | LIPID | /note="S-geranylgeranyl cysteine" | |
1-207 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
207 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
1vg8 | D | 100.0 | RAB7_RAT Ras-related protein Rab-7 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
207 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1vg0[1] | A | RAE1_RAT Rab proteins geranylgeranyltransferase component A.. | B | 100.0 /100.0 |
24 /24 |
RAB7_RAT Ras-related protein Rab-7 | |
1vg9[4] | A | RAE1_RAT Rab proteins geranylgeranyltransferase component A.. | B | 100.0 /100.0 |
19 /19 |
RAB7_RAT Ras-related protein Rab-7 | |
1yhn[2] | B | RILP_HUMAN Rab interacting lysosomal protein[65 aa] | A | 100.0 /99.5 |
13 /13 |
RAB7_HUMAN Ras-related protein Rab-7 | |
1yhn[2] | B | RILP_HUMAN Rab interacting lysosomal protein[65 aa] | A | 100.0 /99.5 |
17 /17 |
RAB7_HUMAN Ras-related protein Rab-7 | |
6iyb[3] | B | OSBL1_HUMAN Oxysterol-binding protein-related protein 1[135 aa.. | A | 100.0 /99.4 |
12 /12 |
RAB7A_HUMAN Ras-related protein Rab-7a | |
6wcw[1] | B | RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich .. | A | 100.0 /99.4 |
18 /18 |
RAB7A_HUMAN Ras-related protein Rab-7a | |
7f6j[2] | C | PDZD8_HUMAN PDZ domain-containing protein 8[106 aa] | A | 100.0 /99.4 |
26 /26 |
RAB7A_HUMAN Ras-related protein Rab-7a | |
8kb8[2] | A | WDR91_HUMAN WD repeat-containing protein 91[338 aa] | C | 100.0 /99.4 |
17 /17 |
RAB7A_HUMAN Ras-related protein Rab-7a | |
5z2m[1] | A | OSBL1_MOUSE Oxysterol-binding protein-related protein 1[137 aa.. | B | 88.9 /99.4 |
9 /9 |
RAB7A_MOUSE Ras-related protein Rab-7a | |
5z2m[1] | D | OSBL1_MOUSE Oxysterol-binding protein-related protein 1[136 aa.. | C | 100.0 /99.4 |
7 /7 |
RAB7A_MOUSE Ras-related protein Rab-7a | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
207 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1vg0[7] | F |
GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] |
B | 100.0 /100.0 |
17 /17 |
RAB7_RAT Ras-related protein Rab-7 | |
1vg8[9] | F |
GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. |
A | 100.0 /100.0 |
22 /22 |
RAB7_RAT Ras-related protein Rab-7 | |
1t91[15] | F |
GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] |
A | 100.0 /99.4 |
23 /23 |
RAB7_HUMAN Ras-related protein Rab-7 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
207 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1vg9[4] | J |
K
POTASSIUM ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
RAB7_RAT Ras-related protein Rab-7 | |
1t91[22] | E |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /99.4 |
2 /2 |
RAB7_HUMAN Ras-related protein Rab-7 | |
6iyb[6] | E |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /99.4 |
2 /2 |
RAB7A_HUMAN Ras-related protein Rab-7a | |
6wcw[1] | D |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /99.4 |
5 /5 |
RAB7A_HUMAN Ras-related protein Rab-7a | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
207 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1vg0[1] | G |
PG4
TETRAETHYLENE GLYCOL[13 atoms] |
B | 100.0 /100.0 |
4 /4 |
RAB7_RAT Ras-related protein Rab-7 | |
1vg9[4] | L |
P33
3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL[22 atoms] |
B | 100.0 /100.0 |
5 /5 |
RAB7_RAT Ras-related protein Rab-7 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |