Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[95 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1697459 419 19 Q9Y6K9(NEMO_HUMAN) RecName: Full=NF-kappa-B essential modulator ; Short=NEMO ;AltName: Full=FIP-3;AltName: Full=IkB kinase-associated protein 1; Short=IKKAP1;AltName: Full=Inhibitor of nuclear factor kappa-B kinase subunit gamma; Short=I-kappa-B kinase subunit gamma; Short=IKK-gamma; Short=IKKG; Short=IkB kinase subunit gamma;AltName: Full=NF-kappa-B essential modifier;
QUERYSEQ 
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLL
GELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q9Y6K9(NEMO_HUMAN)]

419
region name description
1-419 CHAIN /note="NF-kappa-B essential modulator" /id="PRO_0000096782"
389-419 ZN_FING /note="CCHC NOA-type"
1-197 REGION /note="Required for interaction with and ubiquitination by MARCHF2"
44-111 REGION /note="Interaction with CHUK/IKBKB"
150-257 REGION /note="Interaction with TANK"
242-350 REGION /note="Ubiquitin-binding (UBAN)"
246-365 REGION /note="Self-association"
251-419 REGION /note="Required for interaction with TNFAIP3"
322-343 REGION /note="Leucine-zipper"
358-395 REGION /note="Disordered"
382-419 REGION /note="Interaction with CYLD"
49-356 COILED
397-397 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
400-400 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
413-413 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
417-417 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105"
1-392 DISORDER predicted by DISOPRED

MONOMER
419
pdb_id a1 identity[%]2 description
4bwn B 98.8 NEMO_HUMAN NF-KAPPA-B ESSENTIAL MODULATOR
3brt D 100.0 NEMO_HUMAN NF-kappa-B essential modulator
3cl3 C 100.0 NEMO_HUMAN NF-kappa-B essential modulator
5aay A 100.0 NEMO_HUMAN NF-KAPPA-B ESSENTIAL MODULATOR 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3brt[4] A IKKB_HUMAN IKKA_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit.. B 100.0
/100.0		 16
/16		 NEMO_HUMAN NF-kappa-B essential modulator
3brv[4] A IKKB_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit.. B 100.0
/100.0		 19
/19		 NEMO_HUMAN NF-kappa-B essential modulator
3cl3[2] A P88961_HHV8 ORF K13[172 aa] C 100.0
/100.0		 9
/9		 NEMO_HUMAN NF-kappa-B essential modulator
3cl3[2] B P88961_HHV8 ORF K13[165 aa] C 100.0
/100.0		 4
/4		 NEMO_HUMAN NF-kappa-B essential modulator
7tv4[2] B UBC_HUMAN Polyubiquitin-C[147 aa] A 100.0
/100.0		 7
/7		 NEMO_HUMAN NF-kappa-B essential modulator
7tv4[2] D UBC_HUMAN Polyubiquitin-C[152 aa] A 100.0
/100.0		 12
/12		 NEMO_HUMAN NF-kappa-B essential modulator
7tv4[1] E RNF31_HUMAN E3 ubiquitin-protein ligase RNF31[27 aa] A 100.0
/100.0		 3
/3		 NEMO_HUMAN NF-kappa-B essential modulator
7tv4[1] E RNF31_HUMAN E3 ubiquitin-protein ligase RNF31[27 aa] C 100.0
/100.0		 5
/5		 NEMO_HUMAN NF-kappa-B essential modulator
6xx0[2] C Ubv-LIN[76 aa] A 100.0
/97.3		 10
/10		 D3DWY0_HUMAN Inhibitor of kappa light polypeptide gene enhancer..
6xx0[2] D Ubv-LIN[76 aa] A 100.0
/97.3		 2
/2		 D3DWY0_HUMAN Inhibitor of kappa light polypeptide gene enhancer..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2jvx[2] B ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 NEMO_HUMAN NF-kappa-B essential modulator
5aay[1] B ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 NEMO_HUMAN NF-KAPPA-B ESSENTIAL MODULATOR
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
419 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3brt[2] D NEMO_HUMAN NF-kappa-B essential modulator[62 aa] B 100.0
/100.0		 15
/15		 NEMO_HUMAN NF-kappa-B essential modulator
3brv[2] D NEMO_HUMAN NF-kappa-B essential modulator[62 aa] B 100.0
/100.0		 16
/16		 NEMO_HUMAN NF-kappa-B essential modulator
3cl3[2] D NEMO_HUMAN NF-kappa-B essential modulator[58 aa] C 100.0
/100.0		 17
/17		 NEMO_HUMAN NF-kappa-B essential modulator
3fx0[10] B NEMO_HUMAN NF-kappa-B essential modulator[71 aa] A 100.0
/100.0		 25
/25		 NEMO_HUMAN NF-kappa-B essential modulator
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.