Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
19227 | 121 | 3 | YP_009724395.1() | |
QUERYSEQ |
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
121 | region | name | description |
1-121 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
121 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
1yo4 | A | 91.6 | YX4_CVHSA Hypothetical protein X4 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |