Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
3578777 | 63 | 6 | P59634(NS6_SARS) | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
QUERYSEQ |
MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP |
63 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-63 | CHAIN | /note="ORF6 protein" /id="PRO_0000106134" |
![]() ![]() |
54-63 | REGION | /note="Critical for disrupting nuclear import" |
![]() |
|||||||
63 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() |
![]() |
J | 100.0 | NS6_SARS ORF6 protein | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
63 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() |
![]() |
C | RAE1L_HUMAN mRNA export factor[328 aa] | A | 100.0 /100.0 |
9 /9 |
NS6_SARS ORF6 protein |
![]() ![]() ![]() ![]() |
![]() |
A | RAE1L_HUMAN mRNA export factor[341 aa] | I | 100.0 /100.0 |
11 /11 |
NS6_SARS ORF6 protein |
![]() ![]() ![]() ![]() ![]() |
![]() |
F | NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu.. | K | 100.0 /100.0 |
1 /1 |
NS6_SARS ORF6 protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |