Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[80 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2634797 165 40 P05161(ISG15_HUMAN) RecName: Full=Ubiquitin-like protein ISG15;AltName: Full=Interferon-induced 15 kDa protein;AltName: Full=Interferon-induced 17 kDa protein; Short=IP17;AltName: Full=Ubiquitin cross-reactive protein; Short=hUCRP;Flags: Precursor;
QUERYSEQ 
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM
NLRLRGGGTEPGGRS
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P05161(ISG15_HUMAN)]

165
region name description
2-157 CHAIN /note="Ubiquitin-like protein ISG15" /id="PRO_0000035986"
158-165 PROPEP /note="Removed in mature form" /id="PRO_0000035987"
2-78 DOMAIN /note="Ubiquitin-like 1"
79-157 DOMAIN /note="Ubiquitin-like 2"
153-157 REGION /note="Involved in the ligation of specific target proteins"
1-165 DISORDER predicted by DISOPRED

MONOMER
165
pdb_id a1 identity[%]2 description
7rbs B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
165 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3r66[8] A NS1_INBLE Non-structural protein 1[96 aa] C 100.0
/100.0		 11
/11		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3[4] B NS1_INBLE Non-structural protein 1[94 aa] A 87.5
/99.3		 8
/8		 ISG15_HUMAN Ubiquitin-like protein ISG15
5tl6[2] B R1AB_CVHSA Replicase polyprotein 1ab[312 aa] C 100.0
/100.0		 12
/13		 ISG15_HUMAN Ubiquitin-like protein ISG15
6ffa[1] A POLG_FMDVO Lbpro[156 aa] B 100.0
/100.0		 9
/10		 ISG15_HUMAN Ubiquitin-like protein ISG15
6xa9[3] A R1AB_SARS2 Non-structural protein 3[313 aa] B 100.0
/100.0		 11
/12		 ISG15_HUMAN ISG15 CTD-propargylamide
7rbs[5] A R1A_SARS2 Papain-like protease[312 aa] B 100.0
/100.0		 22
/23		 ISG15_HUMAN Ubiquitin-like protein ISG15
8oif[1] A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[704 aa.. B 100.0
/100.0		 17
/17		 ISG15_HUMAN Ubiquitin-like protein ISG15
8se9[7] A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. B 100.0
/100.0		 26
/26		 ISG15_HUMAN Ubiquitin-like protein ISG15
8se9[3] C UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] D 100.0
/100.0		 3
/3		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t[4] B K0BWD0_9BETC ORF1ab[319 aa] A 100.0
/100.0		 17
/17		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8[2] A K4LC41_9BETC ORF1a[259 aa] C 100.0
/99.3		 17
/17		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx[1] A L_CCHFI RNA-directed RNA polymerase L[162 aa] B 100.0
/100.0		 19
/19		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx[1] A L_CCHFI RNA-directed RNA polymerase L[162 aa] B 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
3pse[1] A Q6TQF5_9VIRU RNA polymerase[164 aa] B 100.0
/98.7		 15
/15		 ISG15_HUMAN Ubiquitin-like protein ISG15
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
165 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8oif[5] D AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3[2] C SIN
SUCCINIC ACID[8 atoms] 		A 100.0
/99.3		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3[2] D SIN
SUCCINIC ACID[8 atoms] 		A 100.0
/99.3		 7
/7		 ISG15_HUMAN Ubiquitin-like protein ISG15
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
165 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3phx[1] H ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx[4] N ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx[2] P ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
1z2m[1] B OS4
OSMIUM 4+ ION[1 atoms] 		A 100.0
/99.3		 3
/3		 UCRP_HUMAN interferon, alpha-inducible protein (clone IFI-15K..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
165 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3phx[2] M NEH
ETHANAMINE[3 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx[2] Q ACY
ACETIC ACID[4 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3pse[1] D GOL
GLYCEROL[6 atoms] 		B 100.0
/98.7		 7
/7		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8[1] G GOL
GLYCEROL[6 atoms] 		C 100.0
/99.3		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8[2] H GOL
GLYCEROL[6 atoms] 		C 100.0
/99.3		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8[1] O GOL
GLYCEROL[6 atoms] 		D 100.0
/99.3		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
6ffa[1] J GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 5
/5		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t[4] K MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		A 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t[1] O MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		C 100.0
/100.0		 4
/4		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t[4] E AYE
prop-2-en-1-amine[4 atoms] 		A 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8[2] I AYE
prop-2-en-1-amine[4 atoms] 		C 100.0
/99.3		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8[2] T PGE
TRIETHYLENE GLYCOL[10 atoms] 		C 100.0
/99.3		 4
/4		 ISG15_HUMAN Ubiquitin-like protein ISG15
3pse[1] C 4LJ
1.7.6 3-bromanylpropan-1-amine[4 atoms] 		B 100.0
/98.7		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.