Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[80 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
3207930	164	29	P01185(NEU2_HUMAN)	RecName: Full=Vasopressin-neurophysin 2-copeptin;AltName: Full=AVP-NPII;Contains: RecName: Full=Arg-vasopressin; AltName: Full=Arginine-vasopressin;Contains: RecName: Full=Neurophysin 2; AltName: Full=Neurophysin-II;Contains: RecName: Full=Copeptin;Flags: Precursor;
QUERYSEQ	MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAGALLLRLVQLA GAPEPFEPAQPDAY

UniProt Feature Tables [P01185(NEU2_HUMAN)]

164
	region	name	description
	1-19	SIGNAL
	20-28	PEPTIDE	/note="Arg-vasopressin" /id="PRO_0000020515"
	32-124	CHAIN	/note="Neurophysin 2" /id="PRO_0000020516"
	126-164	PEPTIDE	/note="Copeptin" /id="PRO_0000020517"
	1-164	DISORDER	predicted by DISOPRED

MONOMER
164
	pdb_id	a1	identity[%]2	description
	2bn2	A	95.3	NEU2_BOVIN NEUROPHYSIN II
	1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.

HETERO
164	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	1jk4[2]	B	Lys Vasopressin[6 aa]	A	100.0 /94.9	14 /14	NEU2_BOVIN NEUROPHYSIN 2
	1npo[5]	B	OXYTOCIN[9 aa]	A	100.0 /95.1	16 /16	NEU2_BOVIN NEUROPHYSIN II
	1npo[2]	B	OXYTOCIN[9 aa]	C	100.0 /93.7	5 /5	NEU2_BOVIN NEUROPHYSIN II
	1npo[2]	C	NEU2_BOVIN NEUROPHYSIN II[79 aa]	A	92.3 /95.1	13 /13	NEU2_BOVIN NEUROPHYSIN II
	1npo[2]	C	NEU2_BOVIN NEUROPHYSIN II[79 aa]	A	100.0 /95.1	4 /4	NEU2_BOVIN NEUROPHYSIN II
	1npo[2]	C	NEU2_BOVIN NEUROPHYSIN II[79 aa]	A	100.0 /95.1	2 /2	NEU2_BOVIN NEUROPHYSIN II
	1npo[2]	A	NEU2_BOVIN NEUROPHYSIN II[81 aa]	C	100.0 /93.7	4 /4	NEU2_BOVIN NEUROPHYSIN II
	1npo[2]	A	NEU2_BOVIN NEUROPHYSIN II[81 aa]	C	100.0 /93.7	4 /4	NEU2_BOVIN NEUROPHYSIN II
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
164	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	2bn2[4]	E	PHE PHENYLALANINE[11 atoms]	A	100.0 /95.3	7 /7	NEU2_BOVIN NEUROPHYSIN II
	2hnu[12]	F	PHE PHENYLALANINE[11 atoms]	A	100.0 /82.3	7 /7	NEU1_BOVIN Oxytocin-neurophysin 1
	2bn2[4]	F	TYR TYROSINE[12 atoms]	A	100.0 /95.3	8 /8	NEU2_BOVIN NEUROPHYSIN II
	2hnu[12]	G	TYR TYROSINE[13 atoms]	A	100.0 /82.3	9 /9	NEU1_BOVIN Oxytocin-neurophysin 1
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
164	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	1jk4[2]	C	CD CADMIUM ION[1 atoms]	A	100.0 /94.9	1 /1	NEU2_BOVIN NEUROPHYSIN 2
	1jk4[2]	D	CD CADMIUM ION[1 atoms]	A	100.0 /94.9	1 /1	NEU2_BOVIN NEUROPHYSIN 2
	1jk4[2]	E	CD CADMIUM ION[1 atoms]	A	100.0 /94.9	1 /1	NEU2_BOVIN NEUROPHYSIN 2
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
164	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	1jk4[4]	A	NEU2_BOVIN NEUROPHYSIN 2[79 aa]	A	92.3 /94.9	13 /13	NEU2_BOVIN NEUROPHYSIN 2
	1npo[2]	A	NEU2_BOVIN NEUROPHYSIN II[81 aa]	A	100.0 /95.1	7 /7	NEU2_BOVIN NEUROPHYSIN II
	2bn2[4]	B	NEU2_BOVIN NEUROPHYSIN II[79 aa]	A	91.7 /95.3	12 /12	NEU2_BOVIN NEUROPHYSIN II
	2hnu[18]	B	NEU1_BOVIN Oxytocin-neurophysin 1[81 aa]	A	66.7 /82.3	15 /15	NEU1_BOVIN Oxytocin-neurophysin 1
	2lbh[2]	B	NEU1_BOVIN Neurophysin 1[92 aa]	A	66.7 /80.0	15 /15	NEU1_BOVIN Neurophysin 1
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.