HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[80 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

3652451

207

P51149(RAB7A_HUMAN)

RecName: Full=Ras-related protein Rab-7a ; EC=3.6.5.2 ;

QUERYSEQ

MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIP
YFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P51149(RAB7A_HUMAN)]

207
	region	name	description
	2-207	CHAIN	/note="Ras-related protein Rab-7a" /id="PRO_0000121121"
	15-22	BINDING	/ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269\|PubMed:20028791"
	34-40	BINDING	/ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269\|PubMed:20028791"
	63-67	BINDING	/ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269\|PubMed:20028791"
	125-128	BINDING	/ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269\|PubMed:20028791"
	156-157	BINDING	/ligand="GTP" /ligand_id="ChEBI:CHEBI:37565" ECO:0000269\|PubMed:20028791"
	205-205	LIPID	/note="S-geranylgeranyl cysteine"
	207-207	LIPID	/note="S-geranylgeranyl cysteine"
	1-207	DISORDER	predicted by DISOPRED

MONOMER

207

pdb_id a¹ identity[%]² description

1vg8 D 100.0 RAB7_RAT Ras-related protein Rab-7

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

207 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1vg0[1] A RAE1_RAT Rab proteins geranylgeranyltransferase component A.. B 100.0
/100.0 24
/24 RAB7_RAT Ras-related protein Rab-7

1vg9[4] A RAE1_RAT Rab proteins geranylgeranyltransferase component A.. B 100.0
/100.0 19
/19 RAB7_RAT Ras-related protein Rab-7

1yhn[2] B RILP_HUMAN Rab interacting lysosomal protein[65 aa] A 100.0
/99.5 13
/13 RAB7_HUMAN Ras-related protein Rab-7

1yhn[2] B RILP_HUMAN Rab interacting lysosomal protein[65 aa] A 100.0
/99.5 17
/17 RAB7_HUMAN Ras-related protein Rab-7

6iyb[3] B OSBL1_HUMAN Oxysterol-binding protein-related protein 1[135 aa.. A 100.0
/99.4 12
/12 RAB7A_HUMAN Ras-related protein Rab-7a

6wcw[1] B RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich .. A 100.0
/99.4 18
/18 RAB7A_HUMAN Ras-related protein Rab-7a

7f6j[2] C PDZD8_HUMAN PDZ domain-containing protein 8[106 aa] A 100.0
/99.4 26
/26 RAB7A_HUMAN Ras-related protein Rab-7a

8kb8[2] A WDR91_HUMAN WD repeat-containing protein 91[338 aa] C 100.0
/99.4 17
/17 RAB7A_HUMAN Ras-related protein Rab-7a

5z2m[1] A OSBL1_MOUSE Oxysterol-binding protein-related protein 1[137 aa.. B 88.9
/99.4 9
/9 RAB7A_MOUSE Ras-related protein Rab-7a

5z2m[1] D OSBL1_MOUSE Oxysterol-binding protein-related protein 1[136 aa.. C 100.0
/99.4 7
/7 RAB7A_MOUSE Ras-related protein Rab-7a

5ldd[2] A G0SGS3_CHATD Mon1[155 aa] C 95.0
/85.1 20
/20 G0SGE1_CHATD Rab small monomeric GTPase-like protein

5ldd[2] B G0SD94_CHATD Ccz1[166 aa] C 100.0
/85.1 6
/6 G0SGE1_CHATD Rab small monomeric GTPase-like protein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

207 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1vg0[7] F GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms] B 100.0
/100.0 17
/17 RAB7_RAT Ras-related protein Rab-7

1vg8[9] F GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato.. A 100.0
/100.0 22
/22 RAB7_RAT Ras-related protein Rab-7

1t91[15] F GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] A 100.0
/99.4 23
/23 RAB7_HUMAN Ras-related protein Rab-7

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

207 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1vg9[4] J K
POTASSIUM ION[1 atoms] B 100.0
/100.0 1
/1 RAB7_RAT Ras-related protein Rab-7

1t91[22] E MG
MAGNESIUM ION[1 atoms] A 100.0
/99.4 2
/2 RAB7_HUMAN Ras-related protein Rab-7

6iyb[6] E MG
MAGNESIUM ION[1 atoms] A 100.0
/99.4 2
/2 RAB7A_HUMAN Ras-related protein Rab-7a

6wcw[1] D MG
MAGNESIUM ION[1 atoms] A 100.0
/99.4 5
/5 RAB7A_HUMAN Ras-related protein Rab-7a

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

207 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1vg0[1] G PG4
TETRAETHYLENE GLYCOL[13 atoms] B 100.0
/100.0 4
/4 RAB7_RAT Ras-related protein Rab-7

1vg9[4] L P33
3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL[22 atoms] B 100.0
/100.0 5
/5 RAB7_RAT Ras-related protein Rab-7

5ldd[2] G SO4
SULFATE ION[5 atoms] C 100.0
/85.1 8
/8 G0SGE1_CHATD Rab small monomeric GTPase-like protein

5ldd[1] H SO4
SULFATE ION[5 atoms] C 80.0
/85.1 5
/5 G0SGE1_CHATD Rab small monomeric GTPase-like protein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
207
	pdb_id	a¹	identity[%]²	description
	1vg8	D	100.0	RAB7_RAT Ras-related protein Rab-7
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
207	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1vg0[1]	A	RAE1_RAT Rab proteins geranylgeranyltransferase component A..	B	100.0 /100.0	24 /24	RAB7_RAT Ras-related protein Rab-7
	1vg9[4]	A	RAE1_RAT Rab proteins geranylgeranyltransferase component A..	B	100.0 /100.0	19 /19	RAB7_RAT Ras-related protein Rab-7
	1yhn[2]	B	RILP_HUMAN Rab interacting lysosomal protein[65 aa]	A	100.0 /99.5	13 /13	RAB7_HUMAN Ras-related protein Rab-7
	1yhn[2]	B	RILP_HUMAN Rab interacting lysosomal protein[65 aa]	A	100.0 /99.5	17 /17	RAB7_HUMAN Ras-related protein Rab-7
	6iyb[3]	B	OSBL1_HUMAN Oxysterol-binding protein-related protein 1[135 aa..	A	100.0 /99.4	12 /12	RAB7A_HUMAN Ras-related protein Rab-7a
	6wcw[1]	B	RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich ..	A	100.0 /99.4	18 /18	RAB7A_HUMAN Ras-related protein Rab-7a
	7f6j[2]	C	PDZD8_HUMAN PDZ domain-containing protein 8[106 aa]	A	100.0 /99.4	26 /26	RAB7A_HUMAN Ras-related protein Rab-7a
	8kb8[2]	A	WDR91_HUMAN WD repeat-containing protein 91[338 aa]	C	100.0 /99.4	17 /17	RAB7A_HUMAN Ras-related protein Rab-7a
	5z2m[1]	A	OSBL1_MOUSE Oxysterol-binding protein-related protein 1[137 aa..	B	88.9 /99.4	9 /9	RAB7A_MOUSE Ras-related protein Rab-7a
	5z2m[1]	D	OSBL1_MOUSE Oxysterol-binding protein-related protein 1[136 aa..	C	100.0 /99.4	7 /7	RAB7A_MOUSE Ras-related protein Rab-7a
	5ldd[2]	A	G0SGS3_CHATD Mon1[155 aa]	C	95.0 /85.1	20 /20	G0SGE1_CHATD Rab small monomeric GTPase-like protein
	5ldd[2]	B	G0SD94_CHATD Ccz1[166 aa]	C	100.0 /85.1	6 /6	G0SGE1_CHATD Rab small monomeric GTPase-like protein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
207	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1vg0[7]	F	GDP GUANOSINE-5'-DIPHOSPHATE[28 atoms]	B	100.0 /100.0	17 /17	RAB7_RAT Ras-related protein Rab-7
	1vg8[9]	F	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..	A	100.0 /100.0	22 /22	RAB7_RAT Ras-related protein Rab-7
	1t91[15]	F	GTP GUANOSINE-5'-TRIPHOSPHATE[32 atoms]	A	100.0 /99.4	23 /23	RAB7_HUMAN Ras-related protein Rab-7
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
207	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1vg9[4]	J	K POTASSIUM ION[1 atoms]	B	100.0 /100.0	1 /1	RAB7_RAT Ras-related protein Rab-7
	1t91[22]	E	MG MAGNESIUM ION[1 atoms]	A	100.0 /99.4	2 /2	RAB7_HUMAN Ras-related protein Rab-7
	6iyb[6]	E	MG MAGNESIUM ION[1 atoms]	A	100.0 /99.4	2 /2	RAB7A_HUMAN Ras-related protein Rab-7a
	6wcw[1]	D	MG MAGNESIUM ION[1 atoms]	A	100.0 /99.4	5 /5	RAB7A_HUMAN Ras-related protein Rab-7a
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
207	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1vg0[1]	G	PG4 TETRAETHYLENE GLYCOL[13 atoms]	B	100.0 /100.0	4 /4	RAB7_RAT Ras-related protein Rab-7
	1vg9[4]	L	P33 3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL[22 atoms]	B	100.0 /100.0	5 /5	RAB7_RAT Ras-related protein Rab-7
	5ldd[2]	G	SO4 SULFATE ION[5 atoms]	C	100.0 /85.1	8 /8	G0SGE1_CHATD Rab small monomeric GTPase-like protein
	5ldd[1]	H	SO4 SULFATE ION[5 atoms]	C	80.0 /85.1	5 /5	G0SGE1_CHATD Rab small monomeric GTPase-like protein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[80 %]

UniProt Feature Tables [P51149(RAB7A_HUMAN)]